PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.ZWY76
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family SBP
Protein Properties Length: 465aa    MW: 52712.9 Da    PI: 6.2338
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.ZWY76genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.82.6e-42172248177
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                  +Cqv gC++dls+ k+yh+rhkvC+vhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCrrrLa+hnerrrk+q
  Araip.ZWY76 172 VCQVYGCDMDLSSSKDYHKRHKVCDVHSKTAKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRRRLAGHNERRRKPQ 248
                  6**************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.1E-34167234IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.847170247IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.71E-40171252IPR004333Transcription factor, SBP-box
PfamPF031105.7E-32173246IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MEPWSYVTDE KGYLFSDEMD FSLDAFVRSR KAMTEWDNKA SCNFERGGLN SEREVVRSME  60
FVDLGFPDLF RKPFELDSNL SRRGNTSAQV IDLDSFLGEE ESESKHLSSL GELKAHDTSL  120
IDLKLGRIAD CQAASNDKVG NEGFTLIPMQ QPSPTTLAKR ARTSCSPNQT PVCQVYGCDM  180
DLSSSKDYHK RHKVCDVHSK TAKVIVNGIE QRFCQQCSRF HLLAEFDDGK RSCRRRLAGH  240
NERRRKPQFD YMTSRQHKIL HSHQGARYME SSLQKRPQFS FPDIFRCGTL FPAKYDKISQ  300
NGNVKLEEEF IFSPQFAAPV AHGQELSSRA LSLLSAQSQI PSCHSEENPV ASSFSFHSIS  360
EMPLDISNEG KYVVDESFPC EMNHKEFIKS ESAMLSDAGH PDHRAISDDI CQASDLFNVK  420
QHCSPLEHGS TVDLFQLSSN LERVEQKRNS VSVKWENEDS CFPAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-291722461084squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.ZWY76
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF3122270.0KF312227.1 Arachis hypogaea squamosa promoter-binding-like protein (SPL6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016202918.10.0squamosa promoter-binding-like protein 6 isoform X1
RefseqXP_025654898.10.0squamosa promoter-binding-like protein 6
TrEMBLA0A444Z4920.0A0A444Z492_ARAHY; Uncharacterized protein
STRINGXP_007153485.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.12e-52SBP family protein