PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.ZAW1M
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 274aa    MW: 30104.5 Da    PI: 7.4498
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.ZAW1MgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.72.3e-32154207255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  pr+rWt+ LH+rFv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Araip.ZAW1M 154 PRMRWTTSLHARFVHAVQLLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 207
                  9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.24E-15151208IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-28152208IPR009057Homeodomain-like
TIGRFAMsTIGR015578.2E-24154207IPR006447Myb domain, plants
PfamPF002491.2E-7155206IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MGENVIPDLS LQISLPKSAP PSICNNEEEG DCGGFDIWRS STTTSDGAEK SHSDGSISIP  60
TFLHHHKNME TQLSLAAPTT PTPSEAESPW NKSSSSEQVS LRTLNHHHLF GVIGGANNNT  120
DFTNGFVMRS RMFPSSTTTT RMMIHSSKRN MRAPRMRWTT SLHARFVHAV QLLGGHERAT  180
PKSVLELMDV KDLTLAHVKS HLQMYRTVKN TDKPAASSAS DGDEDFMSLA SPISQNKNFL  240
PNQRGPPNNN NASLDQDLGY NTTTATTCSN KNLW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A9e-18155209458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B9e-18155209458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-17155209357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-17155209357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-17155209357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-17155209357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A9e-18155209458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C9e-18155209458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D9e-18155209458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F9e-18155209458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H9e-18155209458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J9e-18155209458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.ZAW1M
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016203372.10.0transcription repressor KAN1-like isoform X3
RefseqXP_025655566.10.0transcription repressor KAN1 isoform X3
TrEMBLA0A444Z1I60.0A0A444Z1I6_ARAHY; Uncharacterized protein
STRINGXP_007152641.11e-71(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.13e-43G2-like family protein