PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.YQ21T
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 301aa    MW: 33988 Da    PI: 5.9417
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.YQ21TgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260120.11.2e-37101091100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  aCaaCk++rrkC+++C lapyfpa+qpk f nvhklFG+sn++k+lk+++++++++am+s++ +A  r + Pv+G+v+ i +lq+q+  +++el+++ 
  Araip.YQ21T  10 ACAACKFQRRKCTPECLLAPYFPADQPKVFLNVHKLFGVSNIVKILKDVDPSQKKNAMESIIVQASYRDKYPVRGCVEEICRLQNQIWLHEEELHAVY 107
                  7**********************************************************************************************998 PP

       DUF260  99 ee 100
                  ++
  Araip.YQ21T 108 QQ 109
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.5859110IPR004883Lateral organ boundaries, LOB
PfamPF031953.4E-3710106IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MTLKGGTTQA CAACKFQRRK CTPECLLAPY FPADQPKVFL NVHKLFGVSN IVKILKDVDP  60
SQKKNAMESI IVQASYRDKY PVRGCVEEIC RLQNQIWLHE EELHAVYQQL EMCRQHQQQQ  120
HQGIHHVVPD DLASQLELGM APRAANNALP LFNHAPQPQQ QQQQQVYNTS VAALPVSQQH  180
SYSNSNSVDY NSLYIESKEN NNNGTNPLWV PYANNNGSPI AMQSQMVTSQ ALSMQQEAAG  240
DYDEMHPFFE TIDDRQSYIY SKEAYESSSE ESLKDSRKCT EHVAENELKS AAACFSLTSV  300
N
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016176876.10.0PREDICTED: LOB domain-containing protein 27-like
TrEMBLA0A151SMQ21e-147A0A151SMQ2_CAJCA; LOB domain-containing protein 27
STRINGPGSC0003DMT4000342881e-101(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.12e-42LOB domain-containing protein 27