PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.Y465W
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family GeBP
Protein Properties Length: 423aa    MW: 47288.8 Da    PI: 9.6476
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.Y465WgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF5731201.2e-3751146297
       DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                  lfqrlw++eDei lLqG++++++++g+s ++d+  fy+++k++++++++k+qlveKirrLKkK+++  +k+ sgke++f+++hdq +fe+s+kiW 
  Araip.Y465W  51 LFQRLWTDEDEIELLQGFLEYTSQRGSSHHNDTALFYDQIKSKLQLDFNKNQLVEKIRRLKKKYRNVLNKIGSGKEFNFKSAHDQATFEISRKIWS 146
                  79*********************************************************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045045.7E-3552146IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MASEQHDTAP ISTPTANAAT TVVVALEGSS SDPKRQQQIE EKKPLDDSRR LFQRLWTDED  60
EIELLQGFLE YTSQRGSSHH NDTALFYDQI KSKLQLDFNK NQLVEKIRRL KKKYRNVLNK  120
IGSGKEFNFK SAHDQATFEI SRKIWSNLGP RSRPRSSAAT TVKIEERRES LDGSASHKEH  180
NFNLNAAATG LPATPNNNCE SNKCSGGYGI PGLVEETVRS CLSPLVKELV GGAAMGGGHF  240
GGRGFGGGGF SLNPIPLGFG AMNNLGLGLG GGELVDERWR KQQILELEVY SKRLELVQEQ  300
IKAALEELHR ALKLFLNFVS AVMLLPAQTN LKKFGRIVDN ELFGKFQQKY GKRCKERSAG  360
RCWKTRLIIC LTTQQVGSSY SSNVTLVYDR PLFTSPITCI EISELMIYHK QKWKWEKEHA  420
AIG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1240248GGRGFGGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016205453.10.0PREDICTED: LOW QUALITY PROTEIN: mediator-associated protein 1
TrEMBLA0A151TXN01e-119A0A151TXN0_CAJCA; Uncharacterized protein
STRINGGLYMA19G43180.11e-111(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32553365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.24e-54DNA-binding storekeeper protein-related transcriptional regulator