PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.XQA0A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 339aa    MW: 39104.5 Da    PI: 6.7913
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.XQA0AgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.82.9e-5571361129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                  +ppGfrFhPtdeelv++yL+kkv++++++l +vik+vd+yk+ePwdL++  ++ + e++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk+++s 
  Araip.XQA0A   7 VPPGFRFHPTDEELVDYYLRKKVNSTRIDL-DVIKDVDLYKIEPWDLQElcRLGTeEQNEWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAIYS- 102
                  69****************************.9***************954544442566**************************************. PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                  k+ l+g++ktLvfykgrap+g k+dW+mheyrle
  Araip.XQA0A 103 KHDLIGMRKTLVFYKGRAPNGLKSDWIMHEYRLE 136
                  8899****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.27E-625158IPR003441NAC domain
PROSITE profilePS5100559.8377158IPR003441NAC domain
PfamPF023651.8E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MNTFCHVPPG FRFHPTDEEL VDYYLRKKVN STRIDLDVIK DVDLYKIEPW DLQELCRLGT  60
EEQNEWYFFS HKDKKYPTGT RTNRATAAGF WKATGRDKAI YSKHDLIGMR KTLVFYKGRA  120
PNGLKSDWIM HEYRLETDQT AAATPQEEGW VVCRVFKKRV TSIMRKMSDH DSPSCTWYDD  180
SSFMHQQPDH HFDNSCSSSS KHQLIPNNNC DVFYQQHNNN NLPLHHLPLL HQNNNNPIMA  240
PPFAAINNNE TTAFQEQGKS LIHHQALLYG NLNEEQASSS AAAAAADWRL VDKFVSSQLR  300
EDHHVSKQEL MMPENTNNNN NDNGASTSNS SCPIMDVWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-50615914169Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.XQA0A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020959071.10.0NAC domain-containing protein 7-like
RefseqXP_025657202.10.0NAC domain-containing protein 7
SwissprotF4HYV51e-113NAC26_ARATH; NAC domain-containing protein 26
SwissprotQ9FWX21e-113NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA0A444XBF90.0A0A444XBF9_ARAHY; Uncharacterized protein
STRINGGLYMA12G00760.11e-131(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF126933106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62700.13e-99Arabidopsis NAC domain containing protein 26
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]