PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.XJX1I
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 319aa    MW: 36934.6 Da    PI: 5.8228
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.XJX1IgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM182.11.4e-5661331128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  lppGfrFhPtdeelv +yL++k++g+++el ++i+evd+yk+ePwdLp k  + +++ ewyf+s+rd+ky++g+r+nrat+ gyWkatgkd++v s +
  Araip.XJX1I   6 LPPGFRFHPTDEELVAYYLERKITGRSIEL-DIIAEVDLYKCEPWDLPdKsFLPSKDMEWYFYSPRDRKYPNGSRTNRATRGGYWKATGKDRAVQS-Q 101
                  79****************************.99**************96435566888*************************************9.9 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  +++vg+kktLv+ykgrap+g +t+Wvmheyrl
  Araip.XJX1I 102 KKAVGMKKTLVYYKGRAPHGIRTNWVMHEYRL 133
                  999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.03E-633157IPR003441NAC domain
PROSITE profilePS5100560.3956157IPR003441NAC domain
PfamPF023652.2E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MAPMSLPPGF RFHPTDEELV AYYLERKITG RSIELDIIAE VDLYKCEPWD LPDKSFLPSK  60
DMEWYFYSPR DRKYPNGSRT NRATRGGYWK ATGKDRAVQS QKKAVGMKKT LVYYKGRAPH  120
GIRTNWVMHE YRLIESLPGT PHSSFKDSFS LCRIFKKTIQ VQDKSKEEKE HQALLEEDHS  180
RTCTPTETGI ADDFHAQFAC DEANSSAANS YSMGIAYPSN DIEMSMYGSM HNYQFPQTPL  240
VMEDFPQIDF AETKLLKPEV TEDCMFYDRY GRDCMNGTLE EIISYSFDTE ETIATCVGQN  300
NHTQKETFFL AREKQQLHI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-60116212170NO APICAL MERISTEM PROTEIN
1ut4_B6e-60116212170NO APICAL MERISTEM PROTEIN
1ut7_A6e-60116212170NO APICAL MERISTEM PROTEIN
1ut7_B6e-60116212170NO APICAL MERISTEM PROTEIN
3swm_A7e-60116215173NAC domain-containing protein 19
3swm_B7e-60116215173NAC domain-containing protein 19
3swm_C7e-60116215173NAC domain-containing protein 19
3swm_D7e-60116215173NAC domain-containing protein 19
3swp_A7e-60116215173NAC domain-containing protein 19
3swp_B7e-60116215173NAC domain-containing protein 19
3swp_C7e-60116215173NAC domain-containing protein 19
3swp_D7e-60116215173NAC domain-containing protein 19
4dul_A6e-60116212170NAC domain-containing protein 19
4dul_B6e-60116212170NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC086, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00205DAPTransfer from AT1G54330Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.XJX1I
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Regulated by the transcription factor APL (AC Q9SAK5). {ECO:0000269|PubMed:25081480}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016168640.10.0NAC domain-containing protein 86-like
SwissprotA4VCM09e-86NAC45_ARATH; NAC domain-containing protein 45
TrEMBLA0A444Y0Z40.0A0A444Y0Z4_ARAHY; Uncharacterized protein
STRINGGLYMA15G41825.11e-160(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF105083341
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54330.19e-98NAC domain containing protein 20
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]