PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.XJ3T4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 342aa    MW: 37622.6 Da    PI: 7.9188
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.XJ3T4genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM54.15.2e-173380149
          NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49
                 lppGfrFhPtdeel+++yL +k+++++++  ++i++vd++k+ePw+Lp+
  Araip.XJ3T4 33 LPPGFRFHPTDEELITCYLINKISDSNFSG-RAITDVDLNKCEPWELPA 80
                 79*************************999.89**************93 PP

2NAM682.5e-218013277128
          NAM  77 atksgyWkatgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                  at++gyWk+tgkdke+l++ ++elvg+kktLvfykgrap+gek++Wvmheyr+
  Araip.XJ3T4  80 ATNTGYWKTTGKDKEILNSvTSELVGMKKTLVFYKGRAPRGEKSNWVMHEYRI 132
                  6899*************9989999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100525.8981153IPR003441NAC domain
SuperFamilySSF1019412.75E-4630153IPR003441NAC domain
PfamPF023656.8E-2134132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MQKEKEAITA NKEGTNKKDI GIMECCHGKE ETLPPGFRFH PTDEELITCY LINKISDSNF  60
SGRAITDVDL NKCEPWELPA TNTGYWKTTG KDKEILNSVT SELVGMKKTL VFYKGRAPRG  120
EKSNWVMHEY RIHSKSTFRT TKDEWVVCRV FQKSAGAKKY PSSNHASRAM NPFNLEIGHH  180
NIVPPPPMMQ LGDPAAAHFL YGRNYMNTAE LAEVARVLRV GTGSTSTNLP GMQPQINYPV  240
AASSPGVGFT ISGLNLNLGG GGGGTVVATT QPVLRPMQPT PPSQTLGMVP HHQVHHDVSS  300
NMISGAENVG YVNEISNTNG GHGNRFMGMD HCMDLDNYWP SY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-35201597174NAC domain-containing protein 19
3swm_B1e-35201597174NAC domain-containing protein 19
3swm_C1e-35201597174NAC domain-containing protein 19
3swm_D1e-35201597174NAC domain-containing protein 19
3swp_A1e-35201597174NAC domain-containing protein 19
3swp_B1e-35201597174NAC domain-containing protein 19
3swp_C1e-35201597174NAC domain-containing protein 19
3swp_D1e-35201597174NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.XJ3T4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025684413.10.0protein CUP-SHAPED COTYLEDON 3 isoform X3
TrEMBLA0A444X7660.0A0A444X766_ARAHY; Uncharacterized protein
STRINGGLYMA04G08320.21e-162(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50733253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.24e-78NAC domain containing protein 38