PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.XE5UF
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 146aa    MW: 16486.7 Da    PI: 5.7367
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.XE5UFgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260117.21e-3651051101
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk +rrkC++dC+++pyfpa++p+kfa+vhk++G snv ++l+ +p+  re+a+++l+ eA++r++dPvyG+vg+i++l +q+++++ ela+++
  Araip.XE5UF   5 RCAACKNQRRKCPSDCIFSPYFPANDPQKFACVHKIYGGSNVGRMLQGIPTYLREQAANALYLEAKWRIDDPVYGSVGIISSLYEQVQNAEIELAKIQ 102
                  6***********************************************************************************************99 PP

       DUF260  99 eel 101
                  +++
  Araip.XE5UF 103 AQI 105
                  885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.1784105IPR004883Lateral organ boundaries, LOB
PfamPF031954.3E-365102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MISGRCAACK NQRRKCPSDC IFSPYFPAND PQKFACVHKI YGGSNVGRML QGIPTYLREQ  60
AANALYLEAK WRIDDPVYGS VGIISSLYEQ VQNAEIELAK IQAQIAFYKL QTQHVEAEPN  120
SEVLQSQSIT MEQFESDNPT ITSWFN
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00381DAPTransfer from AT3G26620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150363e-44AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016164086.11e-107PREDICTED: LOB domain-containing protein 23-like
SwissprotP594673e-46LBD23_ARATH; LOB domain-containing protein 23
TrEMBLG7K3J31e-66G7K3J3_MEDTR; Lateral organ boundaries (LOB) domain protein
STRINGGLYMA14G02440.24e-62(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26620.12e-47LOB domain-containing protein 23