PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.W1UKI
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family Nin-like
Protein Properties Length: 293aa    MW: 33835.3 Da    PI: 6.1781
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.W1UKIgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK83.32.3e-26112162252
       RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  +k +s +++s+yF++pi++AAkeL+v+lT+LK++CR++GI+RWPhRk+ sl
  Araip.W1UKI 112 TKMLSRKMISEYFYMPITQAAKELDVGLTLLKKRCRELGIRRWPHRKLMSL 162
                  7889********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.55298182IPR003035RWP-RK domain
PfamPF020428.0E-21115162IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MFNLYFSGNS NEYPPLECWA HEFSIQDMEC YPSLPFYETL SVEPISTIKD YDFYDIKKGF  60
SVWNEVDAGF DCSEKVVSSS SSLSNNNNEE DKRIRRVMNK RVCREVRSSN STKMLSRKMI  120
SEYFYMPITQ AAKELDVGLT LLKKRCRELG IRRWPHRKLM SLQTLINNVQ ELGKDEGTES  180
EEKLRNAIEI LEKEKKLLEE MPDLQLEDNT KRLRQACFKA NYKKRKLIMG SSSSNSSMES  240
SSSYNIIGHN ATRITSCKGG TMDSIGFISF EDEEDQERDI KSVLSLPPLS HNN
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.W1UKI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025628574.10.0protein RKD3
TrEMBLA0A445AZI40.0A0A445AZI4_ARAHY; Uncharacterized protein
STRINGGLYMA05G01030.29e-93(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.13e-50RWP-RK domain-containing protein