PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.VH3UM
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 273aa    MW: 30745.6 Da    PI: 7.373
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.VH3UMgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding409.2e-131761147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT+ E++++++a +++  + Wk+I + +g  +t  q++s+ qky
      Araip.VH3UM 17 RENWTEPEHDKFLEALQLFDRD-WKKIGAFVG-SKTVIQIRSHAQKY 61
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.22E-161167IPR009057Homeodomain-like
PROSITE profilePS5129414.7681266IPR017930Myb domain
TIGRFAMsTIGR015572.4E-171564IPR006447Myb domain, plants
SMARTSM007171.1E-101664IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-51657IPR009057Homeodomain-like
PfamPF002492.8E-101761IPR001005SANT/Myb domain
CDDcd001673.32E-81962No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
EDAAKKIRKP YTITKSRENW TEPEHDKFLE ALQLFDRDWK KIGAFVGSKT VIQIRSHAQK  60
YFIKVQKSGT SEHLPPPRPK RKAAHPYPQK ASKNAPLLSQ LSESFQSSSA LLESGYVLKH  120
DPSTMLKTPI MNTVVPSWSN STLQTTNLLH VPKVNDPSGS SESTPRVQPG DESNGQGNSS  180
FPLRVLPDFT QVYSFIGSVF DPNTTDHLHK LKNMDRIDVE TVLLLMRNLS VNLTSPDFED  240
HRKVLSTYEV ELDTDDYINA DILQDDQLKS AAT
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.VH3UM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF2086810.0KF208681.1 Arachis hypogaea putative MYB-related protein 27 (MYB27) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016204322.10.0protein REVEILLE 6
RefseqXP_025656927.10.0protein REVEILLE 6
SwissprotQ8H0W31e-106RVE6_ARATH; Protein REVEILLE 6
TrEMBLV5T7180.0V5T718_ARAHY; Putative MYB-related protein 27
STRINGXP_004516868.11e-156(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.23e-89MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]