PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.V3RAV
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family VOZ
Protein Properties Length: 451aa    MW: 50848.1 Da    PI: 5.3622
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.V3RAVgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ412.76.8e-1272024191217
          VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelfdl 98 
                  pppsaflgpkc+lwdc+rpaqg + +qdycss h+ la neglpg+tp+lrp+gi++kdg+lfaal ak+qgkevgip+cegaa++kspw+a+elfdl
  Araip.V3RAV 202 PPPSAFLGPKCSLWDCFRPAQGLQICQDYCSSGHELLANNEGLPGMTPILRPGGIGVKDGPLFAALLAKTQGKEVGIPKCEGAASTKSPWKAPELFDL 299
                  89************************************************************************************************ PP

          VOZ  99 sllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvde.kks 195
                  s+leget+rewlffd+prraf sgnrkqrslpdy+grgwhesrkqvmke+gg+krsyymdpqp+s++ewhlyeyein++d+lalyrlelk vd+ kks
  Araip.V3RAV 300 SFLEGETLREWLFFDQPRRAFVSGNRKQRSLPDYNGRGWHESRKQVMKEHGGHKRSYYMDPQPLSYLEWHLYEYEINNQDSLALYRLELKFVDNkKKS 397
                  *******************************************************************************************9862579 PP

          VOZ 196 akgkvskdsladlqkklgrlta 217
                  +k+k++k+sladlq+k+g+l+a
  Araip.V3RAV 398 PKAKLTKESLADLQNKMGKLSA 419
                  9*******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MMKDNLKNKC GSSSHQSMKE KEKHHLDKIQ GIFINLQSSR KENRYKDIVM FEEQMHQLLR  60
EWKAELESPA TSLAEGSLGS FPGELAQLLQ ELEENDDAIS PLEKPETLKT QLHPHTVHDV  120
NYPSFHEKSF DDSHMLHDTF EGFGQFDGPA STLQSDTSDM ITQLDSHTLV IEEGFDYGQF  180
FENEAKQCEE DTMPNVLPNI CPPPSAFLGP KCSLWDCFRP AQGLQICQDY CSSGHELLAN  240
NEGLPGMTPI LRPGGIGVKD GPLFAALLAK TQGKEVGIPK CEGAASTKSP WKAPELFDLS  300
FLEGETLREW LFFDQPRRAF VSGNRKQRSL PDYNGRGWHE SRKQVMKEHG GHKRSYYMDP  360
QPLSYLEWHL YEYEINNQDS LALYRLELKF VDNKKKSPKA KLTKESLADL QNKMGKLSAD  420
VLGDDGGTAD GKIKAKSENG GSPEHETKNP E
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.V3RAV
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016170355.10.0transcription factor VOZ1
RefseqXP_025669465.10.0transcription factor VOZ1
SwissprotQ9SGQ01e-148VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A445BXU80.0A0A445BXU8_ARAHY; Uncharacterized protein
STRINGGLYMA06G43890.30.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14983494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-145vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]