PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.UMW8F
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family Nin-like
Protein Properties Length: 296aa    MW: 33981.4 Da    PI: 6.5139
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.UMW8FgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK83.32.3e-26100150252
       RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  +k +s +++s+yF++pi++AAkeL+v+lT+LK++CR++GI+RWPhRk+ sl
  Araip.UMW8F 100 TKMLSRKMISEYFYMPITQAAKELDVGLTLLKKRCRELGIRRWPHRKLMSL 150
                  7889********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.54186170IPR003035RWP-RK domain
PfamPF020428.2E-21103150IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
GNTNEYPPLG CWAHELECYP SLPFYETLSI EPISTIKDCD FYDIKKGFSV WNEVDVGFDC  60
SEKISSSSSS LSNNNNEENK SIRRVMNKRV CREERSSNST KMLSRKMISE YFYMPITQAA  120
KELDVGLTLL KKRCRELGIR RWPHRKLMSL QTLITNVQEL GKEEGRESEE KLRNAIEILE  180
KEKKLLEEMP DMQLEDNTKR LRQACFKANY KKRKLMMGCT SSNSSVESSS SSSYHIIGHN  240
ALRTASQSNT MGGVEFISFD DDEDQERDIK SVLSLPSLSH NIQMCSSYMF NHPSGE
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.UMW8F
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020979105.10.0protein RKD3-like
RefseqXP_025628540.10.0protein RKD3-like
TrEMBLA0A445AZT20.0A0A445AZT2_ARAHY; Uncharacterized protein
STRINGGLYMA05G01030.21e-90(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.13e-42RWP-RK domain-containing protein