PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.UA0W9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 277aa    MW: 31797.9 Da    PI: 6.8047
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.UA0W9genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.93.2e-5671331129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhPtdee++++yL++kv ++++++ ++i evd++k+ePwdLpkk+k +ek+wyfF +rd+ky+tg r+nrat+sgyWkatgkdke+++ +++
  Araip.UA0W9   7 LPPGFRFHPTDEEIISYYLTHKVLNTSFTA-TAIGEVDLNKCEPWDLPKKAKMGEKDWYFFWQRDRKYPTGIRTNRATESGYWKATGKDKEIYK-GRN 102
                  79*************************999.88***************99999*****************************************.999 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrle 129
                  lvg+kktLvfy+grap+g+kt+Wvmhe+rle
  Araip.UA0W9 103 LVGMKKTLVFYRGRAPNGHKTNWVMHEFRLE 133
                  ****************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-614158IPR003441NAC domain
PROSITE profilePS5100556.7767157IPR003441NAC domain
PfamPF023651.9E-288132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MDAALDLPPG FRFHPTDEEI ISYYLTHKVL NTSFTATAIG EVDLNKCEPW DLPKKAKMGE  60
KDWYFFWQRD RKYPTGIRTN RATESGYWKA TGKDKEIYKG RNLVGMKKTL VFYRGRAPNG  120
HKTNWVMHEF RLEGLFATYN LPIPAKEEWV VSRVFHKNTT EKLNPTIPSG LFRIMKNMNS  180
IGDDDLVDFS SLPPLMDPSN NYDDEHTTTT NNNYVNSMFA SSSDYNITIQ QNKKDMMGIR  240
NNNNNIRALL MYDGPSSSSS EVVAPPLSDL ELGLWDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-50516215170NO APICAL MERISTEM PROTEIN
1ut4_B3e-50516215170NO APICAL MERISTEM PROTEIN
1ut7_A3e-50516215170NO APICAL MERISTEM PROTEIN
1ut7_B3e-50516215170NO APICAL MERISTEM PROTEIN
3swm_A2e-50516218173NAC domain-containing protein 19
3swm_B2e-50516218173NAC domain-containing protein 19
3swm_C2e-50516218173NAC domain-containing protein 19
3swm_D2e-50516218173NAC domain-containing protein 19
3swp_A2e-50516218173NAC domain-containing protein 19
3swp_B2e-50516218173NAC domain-containing protein 19
3swp_C2e-50516218173NAC domain-containing protein 19
3swp_D2e-50516218173NAC domain-containing protein 19
4dul_A3e-50516215170NAC domain-containing protein 19
4dul_B3e-50516215170NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.UA0W9
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016180674.10.0NAC domain-containing protein 100 isoform X2
RefseqXP_025685801.10.0NAC domain-containing protein 87 isoform X2
SwissprotQ9FK441e-100NAC87_ARATH; NAC domain-containing protein 87
TrEMBLA0A444XAC90.0A0A444XAC9_ARAHY; Uncharacterized protein
STRINGAES808161e-109(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.11e-101Arabidopsis NAC domain containing protein 87
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]