PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.U9RGH
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 403aa    MW: 46076 Da    PI: 7.4018
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.U9RGHgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.37.6e-50531782128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                  +pGfrFhPt+eelv +yL++kvegk++++ e i+ +d+y+++Pw+Lp+ ++ +ekewyf+++rd+ky++g+r+nr+t+sgyWkatg d+ + +++ + 
  Araip.U9RGH  53 MPGFRFHPTEEELVEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPALAAIGEKEWYFYVPRDRKYRNGDRPNRVTTSGYWKATGADRMIRTENFRS 149
                  79***************************.89***************8778899******************************************** PP

          NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128
                  +glkktLvfy+g+apkg +t+W+m+eyrl
  Araip.U9RGH 150 IGLKKTLVFYSGKAPKGIRTSWIMNEYRL 178
                  ***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.66E-5552198IPR003441NAC domain
PROSITE profilePS5100555.80452199IPR003441NAC domain
PfamPF023654.0E-2554178IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MAIAAPNSSP TMSLSHSHSH EDGGTTTAAS TTNDNLNGNG KQEDDDHEHD MVMPGFRFHP  60
TEEELVEFYL RRKVEGKRFN VELITFLDLY RYDPWELPAL AAIGEKEWYF YVPRDRKYRN  120
GDRPNRVTTS GYWKATGADR MIRTENFRSI GLKKTLVFYS GKAPKGIRTS WIMNEYRLPQ  180
HETERYQKAE ISLCRVYKRA GVEDHPSLPR CLPTRAPSSR TVDHQKNKQQ PHNDQLNMGF  240
GGNTADGASD NRDHDVTTAL ALSKHNTNNT NNAYRAPSMG LPPLLLPLDD EAAFVLMQQQ  300
HHAGPSSGTT MMDDLNRLVS YQHQYYNSSS SSSNNNNPNH HHHLLMHQQQ QQQQQQQQQQ  360
NPPAIMSLNN TPSPLATAFS DRLWEWNPLP EANQRQYSNM SFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-57401995165NO APICAL MERISTEM PROTEIN
1ut4_B8e-57401995165NO APICAL MERISTEM PROTEIN
1ut7_A8e-57401995165NO APICAL MERISTEM PROTEIN
1ut7_B8e-57401995165NO APICAL MERISTEM PROTEIN
4dul_A8e-57401995165NAC domain-containing protein 19
4dul_B8e-57401995165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.U9RGH
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016177392.10.0NAC domain-containing protein 35
RefseqXP_025629693.10.0NAC domain-containing protein 35
SwissprotQ9ZVP81e-116NAC35_ARATH; NAC domain-containing protein 35
TrEMBLA0A445AYB70.0A0A445AYB7_ARAHY; Uncharacterized protein
STRINGGLYMA17G00650.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72033146
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.21e-113NAC domain containing protein 35
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Okajima K
    Molecular mechanism of phototropin light signaling.
    J. Plant Res., 2016. 129(2): p. 149-57
    [PMID:26815763]
  3. Nakasone Y,Ohshima M,Okajima K,Tokutomi S,Terazima M
    Photoreaction Dynamics of LOV1 and LOV2 of Phototropin from Chlamydomonas reinhardtii.
    J Phys Chem B, 2018. 122(6): p. 1801-1815
    [PMID:29355019]