PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.TXC1J
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family HB-other
Protein Properties Length: 154aa    MW: 17465.4 Da    PI: 6.9109
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.TXC1JgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.82.4e-203085156
                 TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                 rr  +++t++q+  Lee+F+ + +p+ ++r++L ++lgL+ rqVk+WFqNrR++ k
  Araip.TXC1J 30 RRFYHRHTPHQIAKLEEAFNACAHPNDSMRRQLGTELGLEPRQVKFWFQNRRTQAK 85
                 5777899**********************************************988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.01E-191086IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-201687IPR009057Homeodomain-like
PROSITE profilePS5007116.2932787IPR001356Homeobox domain
SMARTSM003891.3E-172991IPR001356Homeobox domain
PfamPF000467.1E-183085IPR001356Homeobox domain
CDDcd000867.51E-163087No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 154 aa     Download sequence    Send to blast
MASPMGSSST AGGATDGTDD EGQNRPQNSR RFYHRHTPHQ IAKLEEAFNA CAHPNDSMRR  60
QLGTELGLEP RQVKFWFQNR RTQAKAQADR SNNCALRREN ERMMAENLMF RESLKNVVCV  120
TCGGPTVTED DCQIRLEQFK LENDFLVQEA STSN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008348615.14e-44PREDICTED: homeobox-leucine zipper protein HDG11-like
RefseqXP_008358175.14e-44PREDICTED: homeobox-leucine zipper protein HDG11-like
SwissprotQ69T582e-42ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBLA5B3F32e-44A5B3F3_VITVI; Putative uncharacterized protein
STRINGVIT_04s0079g00480.t015e-43(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2115934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17920.12e-32homeodomain GLABROUS 12