PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.T9QZJ
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 308aa    MW: 34193.1 Da    PI: 5.4705
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.T9QZJgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.23.8e-40191181100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  aCaaCk++rrkCa+dC+lapyfp++++++f n+hklFG+sn++k++k l+++e+++am+++++++++ra+dPv G+++++++lq q+e + ael+l+ 
  Araip.T9QZJ  19 ACAACKYQRRKCAPDCILAPYFPHDRQRQFLNAHKLFGVSNITKIIKVLNPHEKDEAMKTIIFQSDMRAKDPVGGCYRMVQDLQAQIEFHLAELELVL 116
                  7*********************************************************************************************9987 PP

       DUF260  99 ee 100
                  ++
  Araip.T9QZJ 117 QQ 118
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.04818119IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-3619114IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MSSSNSTITT RTGNSTTQAC AACKYQRRKC APDCILAPYF PHDRQRQFLN AHKLFGVSNI  60
TKIIKVLNPH EKDEAMKTII FQSDMRAKDP VGGCYRMVQD LQAQIEFHLA ELELVLQQLA  120
ILRAQAQHQQ AQHLYNQTAT SNINVSVNGD DSINSDPLTL YSSGGGGGLV VGGNGVNHYH  180
YLQQMPHHEQ CMMVQEVNDS SSNNGTPLQE HANMWSMQNS LSSLSLQGQN SNCSVGDEYD  240
HKPMLDMPSD DRNELGFEPQ DLVQRSDEAV LFKIDDAVIK AETDCFQQVQ DHDLKGAATL  300
FTLTNCTS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016172519.10.0PREDICTED: LOB domain-containing protein 22
TrEMBLA0A0B2PPJ61e-125A0A0B2PPJ6_GLYSO; LOB domain-containing protein 22
STRINGGLYMA08G20550.21e-123(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41333259
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.13e-48LOB domain-containing protein 22