PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.Q65SS
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family HD-ZIP
Protein Properties Length: 724aa    MW: 79025.4 Da    PI: 5.7391
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.Q65SSgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.38.7e-2180135156
                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  +++ +++t++q++eLe+lF+++++p++++r eL+k+l L++rqVk+WFqNrR+++k
  Araip.Q65SS  80 KKRYHRHTPQQIQELESLFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMK 135
                  678899***********************************************999 PP

2START150.81.2e-472994904175
                  HHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-SEEEEEEEECTT. CS
        START   4 eeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv.......dsgealrasgvvdmvlallveellddkeqWdetlakaetlevissg. 88 
                  ++a++elvk+a++ ep+W +s      e +n +e++++f+           + +ea+r++g+v+ ++  lve+l+d +e +  ++a+ +t+evis+g 
  Araip.Q65SS 299 LAAMDELVKMAQSCEPLWIRSLeiggrEVLNHEEYIRTFPNP-CialrtnsFVSEASRETGLVIINSLALVETLMDAAEMFPCMIARTSTTEVISNGi 395
                  789************************9***********664.259999999********************************************** PP

                  .....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--...-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SS CS
        START  89 .....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe..sssvvRaellpSgiliepksnghskvtwvehvdlkgr 175
                       galqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvS+d  ++ ++   + +v +++lpSg+++++++ng+skvtwveh+++++r
  Araip.Q65SS 396 ngsrnGALQLMHAELQVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSIDAIRETSSagAPTFVNCRRLPSGCIVQDMPNGYSKVTWVEHAEYEER 490
                  ****************************************************9999999*********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.71E-2162137IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.8E-2265137IPR009057Homeodomain-like
PROSITE profilePS5007117.55677137IPR001356Homeobox domain
SMARTSM003893.8E-1778141IPR001356Homeobox domain
CDDcd000861.48E-1879137No hitNo description
PfamPF000462.5E-1880135IPR001356Homeobox domain
PROSITE patternPS000270112135IPR017970Homeobox, conserved site
PROSITE profilePS5084831.391287507IPR002913START domain
SuperFamilySSF559614.12E-25288488No hitNo description
CDDcd088752.39E-94291490No hitNo description
SMARTSM002341.4E-24296519IPR002913START domain
PfamPF018527.2E-39299490IPR002913START domain
SuperFamilySSF559614.81E-19527717No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 724 aa     Download sequence    Send to blast
MFNSPGLSLA LQQTNLDGQG DVNNNNIMGS ENNNNNYEGS NGGLRRSREE EHESRSGSDN  60
MDGASGDEQD AADNNNPKRK KRYHRHTPQQ IQELESLFKE CPHPDEKQRL ELSKRLCLET  120
RQVKFWFQNR RTQMKTQLER HENTLLRQEN DKLRAENMSI RDAMRNPMCS NCGGPAIIGE  180
LSLEEQHLRI ENARLKDELD RVCALAGKFL GRPISSMGGP HPLPNSSLEL GVGNNNNGYG  240
CNLSINVPNS LPLGPEFGVN LSSPLGMVSG PAITRPQPSA VVGGFDRSME RSMLLELGLA  300
AMDELVKMAQ SCEPLWIRSL EIGGREVLNH EEYIRTFPNP CIALRTNSFV SEASRETGLV  360
IINSLALVET LMDAAEMFPC MIARTSTTEV ISNGINGSRN GALQLMHAEL QVLSPLVPVR  420
EVNFLRFCKQ HAEGVWAVVD VSIDAIRETS SAGAPTFVNC RRLPSGCIVQ DMPNGYSKVT  480
WVEHAEYEER ESLVELWHGL RRPAVDRHPT APVRVPRHPH CARDPGEPPG IVLSAATSVW  540
LPVSPQRLFD FLRDERLRSE WDILSNGGPM QEMAHIAKGQ DHGNCVSLLR AGAINSNQSS  600
MLILQETCID AAGSLVVYAP VDIPAMHVVM NGGDSAYVAL LPSGFAIVPD GPGPRGAQNG  660
GAEANGGDDL GGGARGSGSL LTVAFQILVN SLPTAKLTVE SVETVNNLIS CTVQKIKAAL  720
RCES
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.Q65SS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020991942.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLM1CNN20.0M1CNN2_SOLTU; Uncharacterized protein
STRINGcassava4.1_001764m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.20.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]