PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.Q3R6H
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 360aa    MW: 41047.8 Da    PI: 6.3189
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.Q3R6HgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.32.2e-51181442128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 
                  ppGfrFhP+deel+v+yL++++++++l++ ++i+e+d+yk++PwdLpkk+  +e+ewyfFs+rd+ky++g r+nra+ sgyWkatg+dk++l++ +++
  Araip.Q3R6H  18 PPGFRFHPSDEELIVHYLQNRISSRPLPA-SIIAEIDLYKYNPWDLPKKALFGEEEWYFFSPRDRKYPNGLRPNRAAGSGYWKATGTDKPILTSyGSK 114
                  9****************************.89***************8888899**************************************998899 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                   +g+kk Lvfy gr pkg+ktdW+m+eyrl
  Araip.Q3R6H 115 RIGVKKALVFYLGRPPKGTKTDWIMNEYRL 144
                  9***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-6311171IPR003441NAC domain
PROSITE profilePS5100560.01717171IPR003441NAC domain
PfamPF023656.8E-2618144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MEEGGGDQHA SNSSYTFPPG FRFHPSDEEL IVHYLQNRIS SRPLPASIIA EIDLYKYNPW  60
DLPKKALFGE EEWYFFSPRD RKYPNGLRPN RAAGSGYWKA TGTDKPILTS YGSKRIGVKK  120
ALVFYLGRPP KGTKTDWIMN EYRLVDTITS PSRLKGSMRL DDWVLCRVRH KGYSSKNSCE  180
NQDNPCEPNM LPNLPRCDEG YPATNMNFHA DMITDYQYKD YQILASILVG GHVPTTESMS  240
SLNLKDGKGN DPITSVHEDG FHREDSSTTV SPLDCYFNSL KRKSNEDNQY ENLISFNRKL  300
NMETAMDDES SIINGGLNFY NQNQSQDDII FNKRAAEPSI NFQELKQSAF IGRYPQCSSD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-711317713171NO APICAL MERISTEM PROTEIN
1ut4_B3e-711317713171NO APICAL MERISTEM PROTEIN
1ut7_A3e-711317713171NO APICAL MERISTEM PROTEIN
1ut7_B3e-711317713171NO APICAL MERISTEM PROTEIN
3swm_A3e-711317716174NAC domain-containing protein 19
3swm_B3e-711317716174NAC domain-containing protein 19
3swm_C3e-711317716174NAC domain-containing protein 19
3swm_D3e-711317716174NAC domain-containing protein 19
3swp_A3e-711317716174NAC domain-containing protein 19
3swp_B3e-711317716174NAC domain-containing protein 19
3swp_C3e-711317716174NAC domain-containing protein 19
3swp_D3e-711317716174NAC domain-containing protein 19
4dul_A3e-711317713171NAC domain-containing protein 19
4dul_B3e-711317713171NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.Q3R6H
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1508918e-38AC150891.3 Medicago truncatula chromosome 2 clone mth2-76a9, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016169387.10.0NAC transcription factor 47-like
RefseqXP_025671148.10.0NAC transcription factor 47
TrEMBLA0A444Y7V40.0A0A444Y7V4_ARAHY; Uncharacterized protein
STRINGGLYMA13G40251.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24162981
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.13e-80NAC domain containing protein 25