PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.Q1JTJ
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 377aa    MW: 43466.2 Da    PI: 6.7318
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.Q1JTJgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1812.9e-5671371129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                  +ppGfrFhPtdeelv++yL+kkv++kk++l +vik+vd+yk+ePwdL++  k+ + ee++wyfFs++dkky+tg+r+nratk+g+Wkatg+dk+++sk
  Araip.Q1JTJ   7 VPPGFRFHPTDEELVDYYLRKKVASKKIDL-DVIKDVDLYKIEPWDLQElcKIGSdEENDWYFFSHKDKKYPTGTRTNRATKAGFWKATGRDKAIYSK 103
                  69****************************.9***************954555553556*************************************** PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                  ++ l+g++ktLvfykgrap+g+k+dW+mheyrle
  Araip.Q1JTJ 104 QHCLIGMRKTLVFYKGRAPNGHKSDWIMHEYRLE 137
                  ********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.05E-605157IPR003441NAC domain
PROSITE profilePS5100559.8377157IPR003441NAC domain
PfamPF023656.0E-298136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MNTFSHVPPG FRFHPTDEEL VDYYLRKKVA SKKIDLDVIK DVDLYKIEPW DLQELCKIGS  60
DEENDWYFFS HKDKKYPTGT RTNRATKAGF WKATGRDKAI YSKQHCLIGM RKTLVFYKGR  120
APNGHKSDWI MHEYRLETNE NGTAPEEGWV VCRVFKKKMA TVRKIGDYDS PCSWYDEQVP  180
FMQDLESSSP IKPPIINNNH YASSYNYHQL QLPCKPEFHQ LMQYNNMNMP RHDDAADNNN  240
NFLQLPQLES PNGGISPFLQ QQDHHHQLLQ QQNSNSNYHL DQVTDWRVLD KFVASQLMSH  300
GHDDNDDDGH NNNNNVSKEV INSYSDASIL HVAQQIAMLA NGSSSSSSSR RPQISHQEYA  360
ASTSTSSSQI DLWKSSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-49615814169Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00136DAPTransfer from AT1G12260Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.Q1JTJ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016164335.10.0NAC domain-containing protein 7 isoform X2
RefseqXP_025628228.10.0NAC domain-containing protein 7
SwissprotQ9FWX21e-133NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA0A445ASR80.0A0A445ASR8_ARAHY; Uncharacterized protein
STRINGXP_007155625.11e-163(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF126933106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-117NAC 007
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]