PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.PTY19
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 189aa    MW: 20830.5 Da    PI: 7.8618
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.PTY19genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.71.1e-4410108199
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+kll++l +++reda++sl+yeAear+rdPvyG+vg i+ lq+q+++l++el++++
  Araip.PTY19  10 PCAACKFLRRKCLPGCIFAPYFPPEEPQKFANVHKIFGASNVTKLLNELLPQQREDAVNSLAYEAEARVRDPVYGCVGAISYLQRQVQRLQKELDAAN 107
                  7*********************************************************************************************9987 PP

       DUF260  99 e 99 
                  +
  Araip.PTY19 108 A 108
                  6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.9479110IPR004883Lateral organ boundaries, LOB
PfamPF031956.1E-4410107IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MASSSSYNSP CAACKFLRRK CLPGCIFAPY FPPEEPQKFA NVHKIFGASN VTKLLNELLP  60
QQREDAVNSL AYEAEARVRD PVYGCVGAIS YLQRQVQRLQ KELDAANADL LRYACNEIPP  120
PHHHVPTLAP PLTPTIHHQL TQRHFGGARI GNDHGIGFYR QSPTTYSFPY SLPWNEDING  180
GGAEGGGLA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAPTransfer from AT5G63090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015954679.11e-139PREDICTED: protein LATERAL ORGAN BOUNDARIES
RefseqXP_016165680.11e-139PREDICTED: protein LATERAL ORGAN BOUNDARIES-like
SwissprotQ9FML42e-72LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLV7AZH41e-97V7AZH4_PHAVU; Uncharacterized protein
STRINGGLYMA06G18861.11e-96(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF109134112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.49e-74LBD family protein