PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.PT231
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 343aa    MW: 37989.7 Da    PI: 6.2382
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.PT231genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM118.95e-37441591128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  l pGf+F+Ptd el++++Lk+kv+gkkl+   vi+e++       +L+    +++ ewyfF+ r kky  g+++nra+k+gyWkatg dk++++++++
  Araip.PT231  44 LSPGFHFNPTDVELLKYFLKRKVTGKKLPN--VIAEINS------HLK----SGDLEWYFFCARGKKYGIGSKTNRAIKNGYWKATGMDKAIVQHDKQ 129
                  579************************887..7888764......564....57789***************************************** PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  +vg+ k+Lvf++g+ap+g+ tdWvmheyrl
  Araip.PT231 130 TVGMMKILVFHTGKAPHGTPTDWVMHEYRL 159
                  ****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.89E-4540182IPR003441NAC domain
PROSITE profilePS5100536.53944182IPR003441NAC domain
PfamPF023653.6E-2446159IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MASSLPQSLS SFPTTIRETV PLLWKGAADQ VAIGKKDYME KGKLSPGFHF NPTDVELLKY  60
FLKRKVTGKK LPNVIAEINS HLKSGDLEWY FFCARGKKYG IGSKTNRAIK NGYWKATGMD  120
KAIVQHDKQT VGMMKILVFH TGKAPHGTPT DWVMHEYRLQ DKDLTDKGIA QDSYVICKVF  180
RKEGHGPRTR SGAQYRKPFN EEDWDDDDHH VVEEGGTPST ALVAPVSIQS TTFDGSSYMK  240
PTSVSCESGP VATSPVPSTP SSDASIHTVN NVNNSTVTDL SKDEKTVPEE NIAAGDLLSK  300
FFEGLEDLES EYTPNGVGLD DFSPHGINYD DLRHLDLIDL NFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-354418315169Stress-induced transcription factor NAC1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.PT231
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016193540.10.0NAC domain-containing protein 82-like
RefseqXP_016193541.10.0NAC domain-containing protein 82-like
RefseqXP_016193542.10.0NAC domain-containing protein 82-like
RefseqXP_025637757.10.0NAC domain-containing protein 82
TrEMBLA0A444ZXY81e-136A0A444ZXY8_ARAHY; Uncharacterized protein
STRINGAET031692e-75(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3045322
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09330.44e-55NAC domain containing protein 82