PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.PF1MQ
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family HD-ZIP
Protein Properties Length: 861aa    MW: 93932.9 Da    PI: 6.4458
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.PF1MQgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.14.9e-21157212156
                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  +++ +++t++q++eLe+lF+++++p++++r eL+k+l L++rqVk+WFqNrR+++k
  Araip.PF1MQ 157 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMK 212
                  688999***********************************************999 PP

2START202.41.9e-633766021206
                  HHHHHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEE CS
        START   1 elaeeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetlev 84 
                  ela+ a++elvk+a+++ep+W +       e +n +e+ +++++  +     + +ea+r++++v+ ++  lv +l+d++ +W+e+++    + +t+ev
  Araip.PF1MQ 376 ELALGAMDELVKMAQSGEPLWIRGMemggrEVLNHEEYSRTVTPCIGlrpngFVSEASRETAIVIINSLPLVDTLMDSN-RWSEMFPcmvaRTSTTEV 472
                  57899*****************99989999999999999999998889***9***************************.****************** PP

                  ECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--S CS
        START  85 issg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksnghskvtwvehvdlkg 174
                  issg      galqlm+aelq+lsplvp R++ f+R+++q+ +g+w++vdvS+d  ++p++  + +v +++lpSg++i++++ng+skvtwveh+++++
  Araip.PF1MQ 473 ISSGingtrnGALQLMQAELQVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSIDTIREPSSaAPTFVSCRRLPSGCVIQDMPNGYSKVTWVEHAEYDE 570
                  ************************************************************************************************** PP

                  SXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
        START 175 rlphwllrslvksglaegaktwvatlqrqcek 206
                  +++h+l+r+lv+sg+ +ga++w atlqrqce+
  Araip.PF1MQ 571 SQIHELYRPLVSSGMGFGAQRWIATLQRQCEC 602
                  ******************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.04E-20140214IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.7E-21148214IPR009057Homeodomain-like
PROSITE profilePS5007117.394154214IPR001356Homeobox domain
SMARTSM003899.9E-18155218IPR001356Homeobox domain
CDDcd000861.44E-18156214No hitNo description
PfamPF000461.5E-18157212IPR001356Homeobox domain
PROSITE patternPS000270189212IPR017970Homeobox, conserved site
PROSITE profilePS5084846.852367605IPR002913START domain
SuperFamilySSF559611.18E-35369602No hitNo description
CDDcd088756.92E-123371601No hitNo description
SMARTSM002344.7E-45376602IPR002913START domain
PfamPF018524.1E-55377602IPR002913START domain
SuperFamilySSF559616.44E-24630854No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 861 aa     Download sequence    Send to blast
MSFGGFLENK QGGGGARMVA EIPYSNGSSN HHHHHHHMEA ATAATIMASG AISHPHLAKS  60
MFNNSPALSL ALQTNMDGQG DVMNNNNRLL VGDNNNNNNN NTTNNNNYEG NMMSNNNGLR  120
RSREEEHESR SGSDNMDGAS GDDDLDAADI NNNKPRKKRY HRHTPQQIQE LEALFKECPH  180
PDEKQRLELS KRLCLETRQV KFWFQNRRTQ MKTQLERHEN TLLRQENDKL RAENMSLREA  240
MRNPICTNCG GPTMIGEISL EEQHLRIENA RLKDELDRVC ALAGKFLGRP IPSIAPHPPL  300
PNSSLELGVG NNNNSSNGGF VVGSTMPLGP DFVGMGISSN TLGVLSPTPP SRGIATTNGM  360
NSSNTSSGYE RSMVLELALG AMDELVKMAQ SGEPLWIRGM EMGGREVLNH EEYSRTVTPC  420
IGLRPNGFVS EASRETAIVI INSLPLVDTL MDSNRWSEMF PCMVARTSTT EVISSGINGT  480
RNGALQLMQA ELQVLSPLVP VREVNFLRFC KQHAEGVWAV VDVSIDTIRE PSSAAPTFVS  540
CRRLPSGCVI QDMPNGYSKV TWVEHAEYDE SQIHELYRPL VSSGMGFGAQ RWIATLQRQC  600
ECLAILMSSA VSPPEHSAIT SSGRRSMLKL AQRMTNNFCA GVCASTVHKW NKLNAGNFGE  660
DVRVMTRKSL DDPGEPPGIV LSAATSVWLP VSPQRLFDFL RDERLRSEWD ILSNGGPMQE  720
MAHIAKGQDH GNCVSLLRAS AMNSNQSSML ILQETCTDAS GSLVVYAPVD IPAMHLVMNG  780
GDSAYVALLP SGFAVAPDGS SGRNDHNTVS QPGGGSLLTV AFQILVNSLP TAKLTVESVE  840
TVNNLISCTV QKIKAALQSE G
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.PF1MQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016198932.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A444ZLZ20.0A0A444ZLZ2_ARAHY; Uncharacterized protein
STRINGXP_007139955.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]