PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.NM8GI
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 229aa    MW: 25208.8 Da    PI: 7.1637
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.NM8GIgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.83.3e-42551541100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+C+++Cvlapyfp + p kf ++h++FGasn++k+l++lpe++r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+a+la+++
  Araip.NM8GI  55 PCAACKILRRRCVEKCVLAPYFPPTGPLKFTIAHRVFGASNIIKFLQELPESQRADAVSSMVYEANARIRDPVYGCAGAICQLQKQVSELQAQLAKAQ 152
                  7***********************************************************************************************99 PP

       DUF260  99 ee 100
                  +e
  Araip.NM8GI 153 AE 154
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.92654155IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-4255152IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MEYKLNSSSS IPIIHVPTKI SNSPPPPSSS PPNSQSQSPI SSAPPSPPPP VVVSPCAACK  60
ILRRRCVEKC VLAPYFPPTG PLKFTIAHRV FGASNIIKFL QELPESQRAD AVSSMVYEAN  120
ARIRDPVYGC AGAICQLQKQ VSELQAQLAK AQAELVNMHC QQTNLVALIC MEMSTSNTHQ  180
SSHQEQQLQH HMMMIQPQNN NNNNNHVDMS CFIDDNNLAS AWEPEPLWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-42461662122LOB family transfactor Ramosa2.1
5ly0_B1e-42461662122LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.NM8GI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016177436.11e-168LOB domain-containing protein 1-like
RefseqXP_025629840.11e-168LOB domain-containing protein 1
SwissprotQ9LQR01e-70LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A445AXW81e-167A0A445AXW8_ARAHY; Uncharacterized protein
STRINGXP_004307415.12e-93(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.14e-58LOB domain-containing protein 1