PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.ND6Q8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family BBR-BPC
Protein Properties Length: 315aa    MW: 35342.9 Da    PI: 9.9118
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.ND6Q8genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind330.54.7e-10183158301
    GAGA_bind   8 e...rnkg.yye...............paaslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalll 86 
                  +   r+   yy+               + ++l   +++++ s++aer a i e ++a+sek++a+a+rd+a+ qrd+a+a+r++a+ erdn+l+al+ 
  Araip.ND6Q8   8 HgnsRHTIdYYRganspwsmasqhqvtEPNALV--MNKKIRSIMAERRA-ILELEAAISEKNEALAARDEALRQRDEAIAQRDNAIRERDNALAALQN 102
                  223576666777888888888765553225666..99********9975.5677777***************************************** PP

    GAGA_bind  87 venslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakk..pkekkak.kkkkksekskkkvkke 181
                  +e++++++l  g +v +g+k +++  +    +++d ++++++  +++a+p++  +++a ++++ kk++++k+  pk+ k+  k kk +e+ +++ ++e
  Araip.ND6Q8 103 REDAINFSL--GNGVQRGSKRMHHPAN-YLDNMTDATYNTKDVPITDAFPVTIIPSDAIKSHQAKKTKENKTisPKAAKTPsKGKKMGEDLNQRASSE 197
                  ***988887..5667799999998877.5689******************999988888777777666555411555444326666666665555555 PP

    GAGA_bind 182 saderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydl 279
                  +  ++ k+e++ +d++ln v++De+ +PvPvC+CtG++rqCYkWGnGGWqS+CCttt+SvyPLP+ +++r+aRi+grKmS+++f++lL++ aa+G+dl
  Araip.ND6Q8 198 G--TKFKSEWDRQDVGLNLVTFDETYMPVPVCTCTGVPRQCYKWGNGGWQSSCCTTTLSVYPLPQLPNKRHARIGGRKMSGSVFTRLLSRFAAQGHDL 293
                  5..78********************************************************************************************* PP

    GAGA_bind 280 snpvDLkdhWAkHGtnkfvtir 301
                  s p+DLkd+WA+HGtn+++ti+
  Araip.ND6Q8 294 SVPLDLKDYWARHGTNRYITIK 315
                  *********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012261.9E-1322315IPR010409GAGA-binding transcriptional activator
PfamPF062171.1E-942315IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MMDDGHKHGN SRHTIDYYRG ANSPWSMASQ HQVTEPNALV MNKKIRSIMA ERRAILELEA  60
AISEKNEALA ARDEALRQRD EAIAQRDNAI RERDNALAAL QNREDAINFS LGNGVQRGSK  120
RMHHPANYLD NMTDATYNTK DVPITDAFPV TIIPSDAIKS HQAKKTKENK TISPKAAKTP  180
SKGKKMGEDL NQRASSEGTK FKSEWDRQDV GLNLVTFDET YMPVPVCTCT GVPRQCYKWG  240
NGGWQSSCCT TTLSVYPLPQ LPNKRHARIG GRKMSGSVFT RLLSRFAAQG HDLSVPLDLK  300
DYWARHGTNR YITIK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016169933.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_016169932.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_016169931.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_016169930.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_016169929.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_016169928.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
RefseqXP_016169927.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
SwissprotQ8S8C61e-124BPC4_ARATH; Protein BASIC PENTACYSTEINE4
TrEMBLA0A0B2Q5R10.0A0A0B2Q5R1_GLYSO; Protein BASIC PENTACYSTEINE4
TrEMBLI1KP400.0I1KP40_SOYBN; Uncharacterized protein
STRINGGLYMA08G01240.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF69743348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21240.21e-120basic pentacysteine 4