PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.N9N0A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 282aa    MW: 30320.2 Da    PI: 7.8146
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.N9N0AgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260122.22.8e-3871061100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC+++C++apyfpa++p++f++vh++FGasnv k+l++l++++reda++sl+++A+ar+r+PvyG++  ++ lqq l+q +a l+ +k
  Araip.N9N0A   7 SCAACKFLRRKCTPECIFAPYFPANDPERFECVHRVFGASNVGKILNELHPSQREDAVKSLAFQAKARLRNPVYGCTFQVSILQQLLRQRRAVLENAK 104
                  6*****************************************************************************************99999888 PP

       DUF260  99 ee 100
                  +e
  Araip.N9N0A 105 RE 106
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.9166107IPR004883Lateral organ boundaries, LOB
PfamPF031955.2E-377103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MSSTPTSCAA CKFLRRKCTP ECIFAPYFPA NDPERFECVH RVFGASNVGK ILNELHPSQR  60
EDAVKSLAFQ AKARLRNPVY GCTFQVSILQ QLLRQRRAVL ENAKRELSAY INPPAIQGPF  120
NPQEKPLTSP PVHLGPPCGS NVVQYSAHLD PSYDPNVVHS SAHLGLSNAM QHNRSLGGGG  180
AVPQPDPWLQ ELLEAQQLAA AVAFREQQQE YLRHNAAAGI EPVATAAPYG GNVSGSGVFG  240
HMGAPSGGQG GEMAPCMGLG TFDSGGSYHP QLQQPPQHGV WH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016195185.10.0PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ32e-46LBD36_ARATH; LOB domain-containing protein 36
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.15e-44ASYMMETRIC LEAVES 2-like 1