PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.N53HM
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family HD-ZIP
Protein Properties Length: 192aa    MW: 22284.2 Da    PI: 9.9321
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.N53HMgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.55.5e-1998152256
                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  rk+ ++tk+q   Le+ F  +++++ ++++eLAkkl+L  rqV vWFqNrRa+ k
  Araip.N53HM  98 RKKLRLTKQQSALLEDSFIHHSTLNPKQKQELAKKLNLRARQVEVWFQNRRARTK 152
                  78889************************************************98 PP

2HD-ZIP_I/II114.56.4e-3798186189
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                  +kk+rl+k+q++lLE+sF ++++L+p++K+ela++L+l++rqv+vWFqnrRARtk+kq+E ++e Lk+++++l+een+rL+ke ++L++
  Araip.N53HM  98 RKKLRLTKQQSALLEDSFIHHSTLNPKQKQELAKKLNLRARQVEVWFQNRRARTKLKQTEAECEILKKWCERLREENKRLQKELQHLKS 186
                  69*************************************************************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.15194154IPR001356Homeobox domain
SuperFamilySSF466891.54E-1895162IPR009057Homeodomain-like
SMARTSM003899.7E-1696158IPR001356Homeobox domain
CDDcd000861.11E-1197155No hitNo description
Gene3DG3DSA:1.10.10.606.0E-1798152IPR009057Homeodomain-like
PfamPF000462.0E-1698152IPR001356Homeobox domain
PROSITE patternPS000270129152IPR017970Homeobox, conserved site
PfamPF021837.5E-9154188IPR003106Leucine zipper, homeobox-associated
SMARTSM003405.5E-9154192IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MMMAFSNNND QELGLGLGLS LVHGENCRQK KKEEEEGPCS NIKAYPSLTL GPEQDSRSSQ  60
SAGVSSFSNS SSSIKRERDE EFLLDLDEEE NKKNGNPRKK LRLTKQQSAL LEDSFIHHST  120
LNPKQKQELA KKLNLRARQV EVWFQNRRAR TKLKQTEAEC EILKKWCERL REENKRLQKE  180
LQHLKSMKTN NK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1146154RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.N53HM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016165761.21e-137homeobox-leucine zipper protein HAT9 isoform X1
RefseqXP_020962274.11e-137homeobox-leucine zipper protein HAT9 isoform X3
RefseqXP_025668891.11e-137homeobox-leucine zipper protein HAT9 isoform X1
SwissprotP466031e-45HAT9_ARATH; Homeobox-leucine zipper protein HAT9
SwissprotP466652e-45HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A445C8F91e-136A0A445C8F9_ARAHY; Uncharacterized protein
STRINGXP_010109438.12e-50(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.11e-44HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]