PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.N3PSA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family HD-ZIP
Protein Properties Length: 293aa    MW: 32276.8 Da    PI: 8.83
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.N3PSAgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.21.2e-17122176256
                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  rk+ +++keq   Lee F+++ +++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Araip.N3PSA 122 RKKLRLSKEQSAFLEESFKEHTTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 176
                  778899***********************************************98 PP

2HD-ZIP_I/II128.62.7e-41122212192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  +kk+rlskeq+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++d+l+een+rL+ke +eLr +lk
  Araip.N3PSA 122 RKKLRLSKEQSAFLEESFKEHTTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCDTLTEENRRLQKELQELR-ALK 212
                  69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.3E-18106172IPR009057Homeodomain-like
SuperFamilySSF466891.3E-18108179IPR009057Homeodomain-like
PROSITE profilePS5007117.151118178IPR001356Homeobox domain
SMARTSM003891.3E-15120182IPR001356Homeobox domain
PfamPF000463.8E-15122176IPR001356Homeobox domain
CDDcd000865.36E-15122179No hitNo description
PROSITE patternPS000270153176IPR017970Homeobox, conserved site
PfamPF021831.6E-11178212IPR003106Leucine zipper, homeobox-associated
SMARTSM003407.7E-26178221IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MELALSLGEA PKSFNLLDNT SKLPNNKDPV GFCIALGAAA SSAGKSSEEE RRGSSDPPVQ  60
LDLLPSTPFX XXXXXXXXXX XXXNGGDGGG GAAAMMRSRR DVEGGEGNDR GTSDDDENGS  120
TRKKLRLSKE QSAFLEESFK EHTTLNPKQK LALAKQLNLR PRQVEVWFQN RRARTKLKQT  180
EVDCEYLKRC CDTLTEENRR LQKELQELRA LKTSQPFYMQ LPATTLTMCP SCERVATNTA  240
ANNNDASQIA SALSLSNKPR ILPFPNTQAH PPPAQKAHQS SSSSFATLFR LFA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1120126TRKKLRL
2170178RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.N3PSA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016207437.11e-164homeobox-leucine zipper protein HOX11
RefseqXP_025662745.11e-164homeobox-leucine zipper protein HOX11
SwissprotP466657e-79HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A444YH981e-163A0A444YH98_ARAHY; Uncharacterized protein
STRINGGLYMA09G16790.11e-112(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.15e-65homeobox from Arabidopsis thaliana