PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.MML9E
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 228aa    MW: 25044.2 Da    PI: 8.2102
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.MML9EgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260130.47.5e-41481471100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+kll ++pe++r da++slvyeA++r++dPvyG++g i++lqqq++ l ael++++
  Araip.MML9E  48 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKLLMEVPENQRADAANSLVYEANVRLKDPVYGCMGAISSLQQQVQYLIAELNAVR 145
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  Araip.MML9E 146 DE 147
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.38847148IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-4048145IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MSRERERSDD EVGKKIKREG DGQKGRRQHM LGSQQQAASG GTLNTITPCA ACKLLRRRCA  60
QECPFSPYFS PHEPQKFASV HKVFGASNVS KLLMEVPENQ RADAANSLVY EANVRLKDPV  120
YGCMGAISSL QQQVQYLIAE LNAVRDEIIK YKLREVNNTI IPSSSHHVML PSSSSSEVVS  180
IAVPPPPPPP NHDILPPNSS TSSSMVYPQQ TDPSNYGTIS SDNISYFG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCR9387108e-46CR938710.1 Medicago truncatula chromosome 5 clone mth2-170k9, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016165559.11e-170PREDICTED: LOB domain-containing protein 15-like
SwissprotQ8L5T57e-79LBD15_ARATH; LOB domain-containing protein 15
TrEMBLV7AZD61e-100V7AZD6_PHAVU; Uncharacterized protein
STRINGGLYMA06G15050.11e-98(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.11e-78LOB domain-containing protein 15