PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.MH65U
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 266aa    MW: 28885.6 Da    PI: 7.5599
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.MH65UgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.91.1e-40481471100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+k+l ++ e +r da++slvyeA+ r+rdPvyG++g i+ lqqq+++l+ae+++++
  Araip.MH65U  48 PCAACKLLRRRCAEECPFSPYFSPHEPQKFAAVHKVFGASNVSKMLMEVGEGQRADAANSLVYEANLRLRDPVYGCMGAISGLQQQIQTLQAEVNAVR 145
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  Araip.MH65U 146 AE 147
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.14247148IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-4048145IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
EVFVILEKER IDEIAKKVKI EGELLTSSCS ESEIEIMGRK QSLNTVTPCA ACKLLRRRCA  60
EECPFSPYFS PHEPQKFAAV HKVFGASNVS KMLMEVGEGQ RADAANSLVY EANLRLRDPV  120
YGCMGAISGL QQQIQTLQAE VNAVRAEILK YKYREAAATA TATLISMNHH HHHHLPSNNQ  180
APIIINNNNN DNNAANSSSQ QQGISQPPLP PPLRPVPPNP SLPSPSTVVL SSSLSSSSAS  240
SVYNNTPPKT TLSHGSITSE SVPYFA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00283DAPTransfer from AT2G30340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150363e-36AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016167584.10.0PREDICTED: LOB domain-containing protein 15
SwissprotQ9AT612e-70LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A0B2PI309e-82A0A0B2PI30_GLYSO; LOB domain-containing protein 13
TrEMBLK7M8659e-82K7M865_SOYBN; Uncharacterized protein
STRINGGLYMA14G38280.23e-81(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.17e-72LOB domain-containing protein 13