PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.LI4LD
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family HD-ZIP
Protein Properties Length: 327aa    MW: 35810.9 Da    PI: 7.5981
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.LI4LDgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.26.7e-19174228256
                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  rk+ ++tkeq   Le+ F+++++++ ++++ LAk+l+L  rqV vWFqNrRa+ k
  Araip.LI4LD 174 RKKLRLTKEQSALLEDSFKQHSTLNPKQKQALAKQLNLRPRQVEVWFQNRRARTK 228
                  788899***********************************************98 PP

2HD-ZIP_I/II124.83.9e-40174263191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rl+keq++lLE+sF+++++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en+rL+ke +eL+ +l
  Araip.LI4LD 174 RKKLRLTKEQSALLEDSFKQHSTLNPKQKQALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTDENRRLQKELQELK-AL 263
                  69*************************************************************************************9.54 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-18159224IPR009057Homeodomain-like
SuperFamilySSF466891.0E-18164231IPR009057Homeodomain-like
PROSITE profilePS5007117.475170230IPR001356Homeobox domain
SMARTSM003893.2E-16172234IPR001356Homeobox domain
CDDcd000861.44E-17174231No hitNo description
PfamPF000463.2E-16174228IPR001356Homeobox domain
PROSITE patternPS000270205228IPR017970Homeobox, conserved site
SMARTSM003403.5E-25230273IPR003106Leucine zipper, homeobox-associated
PfamPF021836.6E-10230264IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009735Biological Processresponse to cytokinin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MGLHHDSTHN NNNIGLHLVL GLALSSSSDS PTQETITTST KIPPYSSSST VTTDDAELLL  60
PSLTLALSGH DVNKNKNDDT QEHHRVQVVP TKANNNKVYS SEDYPSTGDV SAQNSPHHSA  120
VSSFSSGCRR GVKRERDVSA SDEAEAEATE IERLSSRISD EEEDGGTTAS AAARKKLRLT  180
KEQSALLEDS FKQHSTLNPK QKQALAKQLN LRPRQVEVWF QNRRARTKLK QTEVDCEFLK  240
KCCETLTDEN RRLQKELQEL KALKLSQPLY MPPMPAATLT ICPSCDRAVA IGSGGSASNN  300
IKNTPLISLA PKPHHFFSPF TNPSAAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1222230RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00477DAPTransfer from AT4G37790Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.LI4LD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016186424.10.0homeobox-leucine zipper protein HAT22
RefseqXP_025627360.10.0homeobox-leucine zipper protein HAT22 isoform X2
SwissprotP466045e-82HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLA0A445ARE60.0A0A445ARE6_ARAHY; Uncharacterized protein
STRINGXP_004509044.11e-108(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.13e-69HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Liu T,Longhurst AD,Talavera-Rauh F,Hokin SA,Barton MK
    The Arabidopsis transcription factor ABIG1 relays ABA signaled growth inhibition and drought induced senescence.
    Elife, 2017.
    [PMID:27697148]
  3. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]