PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.L2G8B
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 206aa    MW: 22872.7 Da    PI: 5.2411
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.L2G8BgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.77.1e-42351341100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+C+++C+lapyfp ++p kf ++h++FGasn++k+l++lpe++r da+ss+vyeA ar+rdPvyG++g i +lq+q+++l+a+la+++
  Araip.L2G8B  35 PCAACKILRRRCTEKCMLAPYFPPTEPTKFTIAHRVFGASNIIKFLQDLPESQRADAVSSMVYEASARIRDPVYGSAGAICHLQKQVNELRAQLAKAQ 132
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  Araip.L2G8B 133 AE 134
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.58634135IPR004883Lateral organ boundaries, LOB
PfamPF031954.5E-4235132IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MEGSDTNNNT YSNSTSTSSG YPPPPAATVA VVMSPCAACK ILRRRCTEKC MLAPYFPPTE  60
PTKFTIAHRV FGASNIIKFL QDLPESQRAD AVSSMVYEAS ARIRDPVYGS AGAICHLQKQ  120
VNELRAQLAK AQAEVATMQF QQANLVALIY MEMAQQKSSQ QQEFESSPQQ SSMEDFSVPS  180
PHYQQSNINY FEDTPSLNSL WEPLWT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1474995e-50BT147499.1 Lotus japonicus clone JCVI-FLLj-12B19 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016187381.11e-154PREDICTED: LOB domain-containing protein 1
SwissprotQ9LQR01e-75LBD1_ARATH; LOB domain-containing protein 1
SwissprotQ9SK082e-75LBD11_ARATH; LOB domain-containing protein 11
TrEMBLK7M3864e-95K7M386_SOYBN; Uncharacterized protein
STRINGGLYMA13G40370.21e-94(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-71LOB domain-containing protein 1