PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.KXD50
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 65aa    MW: 7527.07 Da    PI: 10.0801
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.KXD50genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM28.64.1e-091948130
          NAM  1 lppGfrFhPtdeelvveyLkkkvegkklel 30
                 lppGfrF+Pt+eel+ +yLk k+ ++ +++
  Araip.KXD50 19 LPPGFRFQPTEEELLFQYLKCKLPASIIPE 48
                 79*******************998776554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.49E-91654IPR003441NAC domain
PROSITE profilePS5100511.2421965IPR003441NAC domain
PfamPF023651.6E-52041IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 65 aa     Download sequence    Send to blast
MMSKKMRFVK KNKNGVRLLP PGFRFQPTEE ELLFQYLKCK LPASIIPEIN VCNYVATTIH  60
GICQL
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.KXD50
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015937760.12e-29NAC domain-containing protein 83 isoform X1
RefseqXP_015937761.12e-29NAC domain-containing protein 83 isoform X2
RefseqXP_025616054.12e-29NAC domain-containing protein 83 isoform X1
RefseqXP_025616055.12e-29NAC domain-containing protein 83 isoform X2
RefseqXP_025672115.12e-29NAC domain-containing protein 83 isoform X1
RefseqXP_025672116.12e-29NAC domain-containing protein 83 isoform X2
TrEMBLA0A444XWL64e-28A0A444XWL6_ARAHY; Uncharacterized protein
STRINGGLYMA08G01280.14e-19(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2113744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.11e-15NAC domain containing protein 83