PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.KTL6D
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 59aa    MW: 6826.86 Da    PI: 4.6017
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.KTL6DgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM514.8e-161056148
          NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                 lppGfrF P+deelv +yL kk++++++    ++ e+d++++ePw+Lp
  Araip.KTL6D 10 LPPGFRFYPSDEELVLHYLYKKITNEEVLK-GTLMEIDLHTCEPWQLP 56
                 79************************9655.78**************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.06E-17859IPR003441NAC domain
PROSITE profilePS5100520.1911059IPR003441NAC domain
PfamPF023653.2E-81153IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 59 aa     Download sequence    Send to blast
MGLRDIGASL PPGFRFYPSD EELVLHYLYK KITNEEVLKG TLMEIDLHTC EPWQLPGTY
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.KTL6D
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006588681.11e-35NAC domain-containing protein 21/22
RefseqXP_028183432.11e-35NAC domain-containing protein 21/22-like
SwissprotQ9FFI52e-15NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A0B2P9H43e-34A0A0B2P9H4_GLYSO; NAC domain-containing protein 21/22
TrEMBLA0A4D6MZ911e-34A0A4D6MZ91_VIGUN; Uncharacterized protein
TrEMBLI1L8E73e-34I1L8E7_SOYBN; Uncharacterized protein
STRINGGLYMA10G04350.15e-35(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1720277
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.24e-21NAC domain containing protein 74
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]