PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.KR4TE
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 170aa    MW: 18783.7 Da    PI: 9.1234
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.KR4TEgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.68e-42391381100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe +r da++slvyeA++r+rdPvyG++g i++lq+q+++l+ael++++
  Araip.KR4TE  39 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKMLMEVPECQRADAANSLVYEANVRLRDPVYGCMGAISTLQHQVQSLQAELNAVR 136
                  7***********************************************************************************************99 PP

       DUF260  99 ee 100
                  +e
  Araip.KR4TE 137 SE 138
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.74738139IPR004883Lateral organ boundaries, LOB
PfamPF031955.0E-4239136IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MPECPEKGKK IKREGDNVSS QMGRRHMLGP AGTLNTITPC AACKLLRRRC AQECPFSPYF  60
SPHEPQKFAS VHKVFGASNV SKMLMEVPEC QRADAANSLV YEANVRLRDP VYGCMGAIST  120
LQHQVQSLQA ELNAVRSEIL KYKLREANNN IIIPSSHHHL PMLPSSGAVS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016179225.11e-119PREDICTED: LOB domain-containing protein 15
SwissprotQ8L5T51e-80LBD15_ARATH; LOB domain-containing protein 15
TrEMBLI1JY971e-103I1JY97_SOYBN; Uncharacterized protein
STRINGGLYMA04G39830.21e-102(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.12e-80LOB domain-containing protein 15