PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.KP5QZ
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 362aa    MW: 40078.2 Da    PI: 9.1608
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.KP5QZgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.53.1e-54231511128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk..k 96 
                  lppGfrFhPtdeelvv+yLkkk+++++l++  +i++vd+yk++Pw+Lp+k++ +++ewyfFs+rd+ky++g r+nra++sgyWkatg+dk++ls+  +
  Araip.KP5QZ  23 LPPGFRFHPTDEELVVHYLKKKASSSPLPV-AIIADVDLYKFDPWELPSKAAFGDQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPILSSdgN 119
                  79****************************.88***************888899****************************************9888 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  +++vg+kk Lvfy g+ pkg+kt+W+mheyrl
  Araip.KP5QZ 120 KQKVGVKKALVFYGGKPPKGVKTNWIMHEYRL 151
                  889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-6518192IPR003441NAC domain
PROSITE profilePS5100562.10523192IPR003441NAC domain
PfamPF023652.7E-2824151IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MIMVDNSTDS SSGAGEQHHH PQLPPGFRFH PTDEELVVHY LKKKASSSPL PVAIIADVDL  60
YKFDPWELPS KAAFGDQEWY FFSPRDRKYP NGARPNRAAT SGYWKATGTD KPILSSDGNK  120
QKVGVKKALV FYGGKPPKGV KTNWIMHEYR LTDNNNNASS SNSSKPPSIP LDPLKKTSLR  180
LDDWVLCRIY KKSNSSSSSL PIPRPAFLMD EEKDLISMES SMVPTMSMSK PRSTSTTGCY  240
GPMALENDDN FFDGILAAST DHHTMQNGNL LPSLITFKQI KLTSSTGSPG SSSSSKRFHG  300
DLNNGDNTSF VSLLNQLPHN TPFHPNSILG SVGDAVLRQQ FQLPGLNWNL INYFALLWWG  360
VL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-722319717170NO APICAL MERISTEM PROTEIN
1ut4_B3e-722319717170NO APICAL MERISTEM PROTEIN
1ut7_A3e-722319717170NO APICAL MERISTEM PROTEIN
1ut7_B3e-722319717170NO APICAL MERISTEM PROTEIN
3swm_A3e-722319720173NAC domain-containing protein 19
3swm_B3e-722319720173NAC domain-containing protein 19
3swm_C3e-722319720173NAC domain-containing protein 19
3swm_D3e-722319720173NAC domain-containing protein 19
3swp_A3e-722319720173NAC domain-containing protein 19
3swp_B3e-722319720173NAC domain-containing protein 19
3swp_C3e-722319720173NAC domain-containing protein 19
3swp_D3e-722319720173NAC domain-containing protein 19
4dul_A3e-722319717170NAC domain-containing protein 19
4dul_B3e-722319717170NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family. May be associated with anther development and pollen production (Probable). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305|PubMed:21107887}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00058PBMTransfer from AT1G61110Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.KP5QZ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016189815.10.0NAC transcription factor 25-like
RefseqXP_025638168.10.0NAC transcription factor 25
SwissprotQ8GY421e-111NAC25_ARATH; NAC transcription factor 25
TrEMBLA0A444ZWW10.0A0A444ZWW1_ARAHY; Uncharacterized protein
STRINGXP_007159283.11e-153(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.11e-108NAC domain containing protein 25