PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.KI83M
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 306aa    MW: 34445.9 Da    PI: 5.3251
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.KI83MgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM147.66.4e-46181441128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                  + pGfrF Ptd el+++yL+kk++g++ ++ ++i+e++++++ePwdLp k++ ++++ew+fFs+r ++y++g++++ratksgyWk tg+++++ s ++
  Araip.KI83M  18 MFPGFRFCPTDGELISYYLRKKLDGDEDSV-QIISELELCTFEPWDLPeKSFIKSNDEWFFFSRRWRRYPNGSQNKRATKSGYWKVTGNERQIES-GQ 113
                  579************************999.89***************656656778*************************************9.99 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  +++g+k+tLvf+ grapkge+t+W++hey +
  Araip.KI83M 114 NVIGTKRTLVFHVGRAPKGERTEWIIHEYCI 144
                  9****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.75E-5210159IPR003441NAC domain
PROSITE profilePS5100550.09618160IPR003441NAC domain
PfamPF023651.3E-2320143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0033619Biological Processmembrane protein proteolysis
GO:0048573Biological Processphotoperiodism, flowering
GO:0071472Biological Processcellular response to salt stress
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MVDRDSSEAH MSIAASSMFP GFRFCPTDGE LISYYLRKKL DGDEDSVQII SELELCTFEP  60
WDLPEKSFIK SNDEWFFFSR RWRRYPNGSQ NKRATKSGYW KVTGNERQIE SGQNVIGTKR  120
TLVFHVGRAP KGERTEWIIH EYCINDKFQD SLVVCRLKRN TKFRANDDSN RTSRESGCGV  180
SEGVTVQMST CVPIQDKEVG CSSKRSNNSN SSPSITVQIK SSDRVANEDN PKASSNESSD  240
RVANEANPKD RVANEANPKA SSNESSDRVA NEANPKASSN HSKVDEVDYY AEINLDDIIN  300
LDEPAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-4091602165NO APICAL MERISTEM PROTEIN
1ut4_B3e-4091602165NO APICAL MERISTEM PROTEIN
1ut7_A3e-4091602165NO APICAL MERISTEM PROTEIN
1ut7_B3e-4091602165NO APICAL MERISTEM PROTEIN
4dul_A3e-4091602165NAC domain-containing protein 19
4dul_B3e-4091602165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP), probably via metalloprotease activity. Regulates gibberellic acid-mediated salt-responsive repression of seed germination and flowering via FT, thus delaying seed germination under high salinity conditions. {ECO:0000269|PubMed:17410378, ECO:0000269|PubMed:18363782, ECO:0000269|PubMed:19704528, ECO:0000269|PubMed:19704545}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00280DAPTransfer from AT2G27300Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.KI83M
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By high salt stress (PubMed:19704545, PubMed:17410378, PubMed:18363782, PubMed:19704528). Repressed by gibberellic acid (GA), but induced by the GA biosynthetic inhibitor paclabutrazol (PAC) (PubMed:18363782). Accumulates transiently in seeds upon imbibition (PubMed:19704545, PubMed:17410378, PubMed:18363782, PubMed:19704528). Induced by drought stress (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:17410378, ECO:0000269|PubMed:18363782, ECO:0000269|PubMed:19704528, ECO:0000269|PubMed:19704545}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016200447.10.0NAC domain-containing protein 40-like
RefseqXP_025651016.10.0NAC domain-containing protein 40-like
SwissprotQ9XIN71e-80NAC40_ARATH; NAC domain-containing protein 40
TrEMBLA0A444YY900.0A0A444YY90_ARAHY; Uncharacterized protein
STRINGGLYMA13G39090.21e-111(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73153346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27300.11e-82NTM1-like 8
Publications ? help Back to Top
  1. Liang M, et al.
    Subcellular Distribution of NTL Transcription Factors in Arabidopsis thaliana.
    Traffic, 2015. 16(10): p. 1062-74
    [PMID:26201836]
  2. Tian H, et al.
    NTL8 Regulates Trichome Formation in Arabidopsis by Directly Activating R3 MYB Genes TRY and TCL1.
    Plant Physiol., 2017. 174(4): p. 2363-2375
    [PMID:28649093]