PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.KB0T7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family GRAS
Protein Properties Length: 428aa    MW: 47468.9 Da    PI: 5.7586
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.KB0T7genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS299.96.4e-9224252373
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvs.elykalppsetsekn...sseelaalkl..fsevsPilkf 93 
                  ++lL++cA+a++++d +laq++L+ l+++a pdgd++qRla  f++AL ar a+++s ++ +a++  ++++++   +++++++ +l  f++++P+++f
  Araip.KB0T7   2 EQLLVHCANAIETNDVTLAQQILWVLNNIAPPDGDSNQRLAGSFLRALTARAANTGScKMLAAVADAAANRNSlaiETHRFSVIELanFVDLTPWHRF 99 
                  79***************************************************94331444455555555455566556666666699********** PP

         GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg........skeeleetgerLakfAeelgvpfefnvl.. 181
                  ++ +aN aIlea+eg + +Hi+D+++++++Q p+L++a+a R e pp +++T+ g++  +           ++ee+g +L +fA++ +v +ef+v+  
  Araip.KB0T7 100 GFTAANAAILEATEGFSVIHIVDLSLTHCMQIPTLIDAIAGRHEVPPVIKLTVPGAAFREgninipplLDLSYEELGAKLVNFARSKNVVMEFSVVss 197
                  ****************************************************999976667899998888999**********************977 PP

         GRAS 182 .....vakrledleleeLrvkp..........gEalaVnlvlqlhrll............................desvsleserdevLklvkslsP 236
                        a+ +e l+++     +          +Eal++n++++lh+++                            + s s++s r+ +Lk+v+sl+P
  Araip.KB0T7 198 syadgFASLIEHLRVQ-----HivsvaeghrpNEALVINCHMMLHYIPdetalvhhhetdsnlnpfivhdysssssSPSSSSSSLRSMFLKAVRSLEP 290
                  7444444444555555.....44444457777****************************************998644444455889*********** PP

         GRAS 237 kvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaa 334
                  +++v+v++++d+ s++++ r+ +a++y +  +d++++ lpr s++r+++E+  + ++i+nv+a+egaer+er e ++kW++r+++a F+ + +s++  
  Araip.KB0T7 291 TIMVLVDEDVDLISNNLVCRLRSAFNYLWIPYDTVDTFLPRGSKQRQWYEAD-ICWKIENVIAHEGAERVERVEPKSKWEQRMRNASFHGIGFSDESI 387
                  ****************************************************.********************************************* PP

         GRAS 335 kqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                  +++k +l +++  g+ v++e++ l+l+Wk+++++++SaW
  Araip.KB0T7 388 SEVKGMLDEHA-AGWGVKKEDDNLLLTWKGHNVIFASAW 425
                  ***********.99************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.0351407IPR005202Transcription factor GRAS
PfamPF035142.2E-892425IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 428 aa     Download sequence    Send to blast
MEQLLVHCAN AIETNDVTLA QQILWVLNNI APPDGDSNQR LAGSFLRALT ARAANTGSCK  60
MLAAVADAAA NRNSLAIETH RFSVIELANF VDLTPWHRFG FTAANAAILE ATEGFSVIHI  120
VDLSLTHCMQ IPTLIDAIAG RHEVPPVIKL TVPGAAFREG NINIPPLLDL SYEELGAKLV  180
NFARSKNVVM EFSVVSSSYA DGFASLIEHL RVQHIVSVAE GHRPNEALVI NCHMMLHYIP  240
DETALVHHHE TDSNLNPFIV HDYSSSSSSP SSSSSSLRSM FLKAVRSLEP TIMVLVDEDV  300
DLISNNLVCR LRSAFNYLWI PYDTVDTFLP RGSKQRQWYE ADICWKIENV IAHEGAERVE  360
RVEPKSKWEQ RMRNASFHGI GFSDESISEV KGMLDEHAAG WGVKKEDDNL LLTWKGHNVI  420
FASAWLPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B3e-52242788474Protein SHORT-ROOT
5b3h_B7e-53242734420Protein SHORT-ROOT
5b3h_E7e-53242734420Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.KB0T7
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016199080.10.0scarecrow-like protein 32
SwissprotQ9SN221e-166SCL32_ARATH; Scarecrow-like protein 32
TrEMBLA0A444ZAI50.0A0A444ZAI5_ARAHY; Uncharacterized protein
STRINGGLYMA05G22140.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77023347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-167GRAS family protein