PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.IRM4P
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family Trihelix
Protein Properties Length: 296aa    MW: 35989.4 Da    PI: 6.4513
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.IRM4PgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix80.32.8e-2547129186
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                  +W+ qe+++ + +r e+++++ ++k++k+lWe +s++m+e+g++rs++qCk+kw+nl +ryk ++++e +     ++++p++++++
  Araip.IRM4P  47 QWSIQETKEFLMIRAELDQTFMETKRNKQLWEVISNNMKEKGYHRSAEQCKCKWKNLVTRYKGCETMEPEA--L-RQQFPFYNEIQ 129
                  7********************************************************************95..3.4589****997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122032.71E-2346111No hitNo description
PfamPF138371.3E-2047131No hitNo description
PROSITE profilePS500907.35248104IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MEGHQHHHQQ PQQHLLQQIL LPHHQQQQHN MIINVDGGGG ISDRFPQWSI QETKEFLMIR  60
AELDQTFMET KRNKQLWEVI SNNMKEKGYH RSAEQCKCKW KNLVTRYKGC ETMEPEALRQ  120
QFPFYNEIQA IFTSRSMQRM LWGEGEGTSK KNKTMQLSSE EEEEEEENNE ESEEHQKGIR  180
MRRKKKKAKI SSGGNNKNSD FLNNLKEILE EFMRQQMQME AQWMEAFESR EKERRMKEME  240
WRQTMEALEN ERIMMDQRWR EREEQRRVRE EVRAQNRDEL ITTLLHKLQQ QSEDDF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1181186RRKKKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016186612.10.0PREDICTED: trihelix transcription factor GT-3b-like
SwissprotQ9SDW01e-68TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLA0A0S3RUB81e-117A0A0S3RUB8_PHAAN; Uncharacterized protein
STRINGGLYMA03G07590.21e-115(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.11e-52Trihelix family protein