PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.I7PN0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 288aa    MW: 31147.1 Da    PI: 8.4023
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.I7PN0genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260379.8e-12453145
       DUF260  1 aCaaCkvlrrkCakdCvlapyf.....paeqpkkfanvhklFGasnvlkl 45
                 +C++C+vlr++C+++C ++p++     p++q++++ +++k++G++ +++l
  Araip.I7PN0  4 SCNGCRVLRKGCSENCSIRPCLqwiksPESQANATVFLAKFYGRAGLMNL 53
                 6*******************************************999876 PP

2DUF26024.66.9e-0853886499
       DUF260 64 eAearardPvyGavgvilklqqqleqlkaelallke 99
                  A+ r+ +P+yG+vg+++++++ql+q+++e++l ++
  Araip.I7PN0 53 LACGRIVNPIYGSVGLLWSGSWQLCQAAVEAVLKGA 88
                 69****************************998766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031956.7E-8453IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MRMSCNGCRV LRKGCSENCS IRPCLQWIKS PESQANATVF LAKFYGRAGL MNLACGRIVN  60
PIYGSVGLLW SGSWQLCQAA VEAVLKGAPI TPITSEAAAN GRGPPLKAYD IRHVTKDDSN  120
SALSTHNPSH PLKTRSRKRS HSQPKPKTKP NAQKLTTTAT TTTTALLNVD EVVNHSASLD  180
HESSLSHQSE LVTAAEGGGE SKERESESIV SVETTAEAAS VLFRDEPESN RKRVERTDED  240
RSGLGLDLTL GFEPVSSSAR ADQVVPVKKR RFDLKDYGEM GLGLECPA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016194776.10.0PREDICTED: LOB domain-containing protein 41
SwissprotQ9M8867e-85LBD41_ARATH; LOB domain-containing protein 41
TrEMBLV7B0181e-119V7B018_PHAVU; Uncharacterized protein
STRINGGLYMA08G48040.21e-113(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15463499
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02550.11e-80LOB domain-containing protein 41