PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.HYM8C
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 395aa    MW: 44491.4 Da    PI: 6.6791
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.HYM8CgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1837.2e-57161431129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhPtdee++++yL++kv ++++++ ++i e+d++k+ePwdLpkk+k +ekewyfF+++d+ky+tg r+nrat+sgyWkatgkdke+++ kg+
  Araip.HYM8C  16 LPPGFRFHPTDEEIITYYLTEKVMNSSFSA-TAIGEADLNKSEPWDLPKKAKMGEKEWYFFCQKDRKYPTGMRTNRATDSGYWKATGKDKEIFKGKGN 112
                  79**************************99.88***************99999********************************************* PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrle 129
                  lvg+kktLvfy+grapkgekt+Wvmhe+rle
  Araip.HYM8C 113 LVGMKKTLVFYRGRAPKGEKTNWVMHEFRLE 143
                  ****************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.05E-6213168IPR003441NAC domain
PROSITE profilePS5100559.02716167IPR003441NAC domain
PfamPF023653.1E-2917142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:1900057Biological Processpositive regulation of leaf senescence
GO:1903648Biological Processpositive regulation of chlorophyll catabolic process
GO:0000975Molecular Functionregulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MEEPVVVNKG EEPLDLPPGF RFHPTDEEII TYYLTEKVMN SSFSATAIGE ADLNKSEPWD  60
LPKKAKMGEK EWYFFCQKDR KYPTGMRTNR ATDSGYWKAT GKDKEIFKGK GNLVGMKKTL  120
VFYRGRAPKG EKTNWVMHEF RLEGKFANYN LPKAAKDEWV VSRVFHKNTD VKKTTTPSSS  180
SSIIPGLLRI NSIGDDLLDC STLPPLMDPH PTPLDTTKSD GYYFPSFSSS HQILNIKPEE  240
HNTSHQIPIT NYQIPNFNTT LSSSSSHQIR LQNHLNLFSS SSSNNNYHNS SWPTYYDEVH  300
HHHQDDILLR AIASKNYSNG GGGAGECKVE QFSSGNQSVV SVSQETGLSN DRTTNDTSSV  360
VSKQQHNNRT LYEDLEGPSS SVAPLSDLEC LWDTY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-531417315171NO APICAL MERISTEM PROTEIN
1ut4_B8e-531417315171NO APICAL MERISTEM PROTEIN
1ut7_A8e-531417315171NO APICAL MERISTEM PROTEIN
1ut7_B8e-531417315171NO APICAL MERISTEM PROTEIN
3swm_A1e-521417318174NAC domain-containing protein 19
3swm_B1e-521417318174NAC domain-containing protein 19
3swm_C1e-521417318174NAC domain-containing protein 19
3swm_D1e-521417318174NAC domain-containing protein 19
3swp_A1e-521417318174NAC domain-containing protein 19
3swp_B1e-521417318174NAC domain-containing protein 19
3swp_C1e-521417318174NAC domain-containing protein 19
3swp_D1e-521417318174NAC domain-containing protein 19
4dul_A8e-531417315171NAC domain-containing protein 19
4dul_B8e-531417315171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that acts as positive regulator of leaf senescence. Activates NYC1, SGR1, SGR2 and PAO, which are genes involved in chlorophyll catabolic processes. Activates senescence-associated genes, such as RNS1, SAG12 and SAG13. {ECO:0000269|PubMed:27021284}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00332DAPTransfer from AT3G04060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.HYM8C
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016162135.10.0NAC domain-containing protein 100
RefseqXP_025658492.10.0NAC domain-containing protein 87
SwissprotQ9SQQ61e-110NAC46_ARATH; NAC domain-containing protein 46
TrEMBLA0A1S3TB571e-178A0A1S3TB57_VIGRR; NAC domain-containing protein 100
STRINGGLYMA19G28515.11e-178(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.11e-108Arabidopsis NAC domain containing protein 87
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Oda-Yamamizo C, et al.
    Corrigendum: The NAC transcription factor ANAC046 is a positive regulator of chlorophyll degradation and senescence in Arabidopsis leaves.
    Sci Rep, 2016. 6: p. 35125
    [PMID:27759025]
  4. O'Shea C, et al.
    Structures and Short Linear Motif of Disordered Transcription Factor Regions Provide Clues to the Interactome of the Cellular Hub Protein Radical-induced Cell Death1.
    J. Biol. Chem., 2017. 292(2): p. 512-527
    [PMID:27881680]