PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.HW40V
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family Trihelix
Protein Properties Length: 308aa    MW: 36085.4 Da    PI: 7.5042
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.HW40VgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix80.32.7e-2553135186
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                  +W+ qe+++ + +r e+++++ ++k++k+lWe +s+ m+e+gf+rs++qCk+kw+nl +ryk ++++e +     ++++p++++l+
  Araip.HW40V  53 QWSIQETKEFLMIRAELDQTFMETKRNKQLWEVISNTMKEKGFHRSAEQCKCKWKNLVTRYKGCETMEAEA---MRQQFPFYNELQ 135
                  7********************************************************************95...56689*****98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122031.46E-2152117No hitNo description
PfamPF138377.0E-2153137No hitNo description
PROSITE profilePS500907.21354110IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0016592Cellular Componentmediator complex
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MESHHLHHHH HHHHQQQYPP PQHHSISAAT TTSAGTNNNV VVVDVTGDSR FPQWSIQETK  60
EFLMIRAELD QTFMETKRNK QLWEVISNTM KEKGFHRSAE QCKCKWKNLV TRYKGCETME  120
AEAMRQQFPF YNELQAIFTD RMQRMLWAEA EGGGGGGGGG GGSSTNKKKA ATAQLSSDEE  180
EEEESELGDP QQKNVKRKKR LKKVKRVEDS GGASNLKHLK GILEEFMRQQ MEMEAQWMSA  240
FEARENDRRL KELEWRQTME ALENQRIMME QRWRESEEQW RIREEDRAHK RDALITALLN  300
KLSRQQDQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1195201KRKKRLK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150372e-62AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016196653.10.0PREDICTED: trihelix transcription factor GT-3b-like
SwissprotO804506e-69TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBLA0A0S3RUB81e-118A0A0S3RUB8_PHAAN; Uncharacterized protein
STRINGGLYMA03G07590.21e-111(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.17e-64Trihelix family protein