PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.HED4C
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NF-YC
Protein Properties Length: 242aa    MW: 26929.1 Da    PI: 7.2188
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.HED4CgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC168.67.5e-53611548101
        NF-YC   8 kqiekatdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdel 101
                  ++iek+tdfknh+lPlarikki+kadedv+misaeaPv++++ace+fileltlrsw+h+eenkrrtl+k+diaaa+trtdifdflvdivpr++l
  Araip.HED4C  61 SEIEKVTDFKNHSLPLARIKKIMKADEDVRMISAEAPVIFARACEMFILELTLRSWNHTEENKRRTLQKNDIAAAITRTDIFDFLVDIVPREDL 154
                  679****************************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471133.02E-3240145IPR009072Histone-fold
PfamPF008081.4E-2173136IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.108.9E-3874151IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MGVDLFDFNC NRMDHQGHGQ NPSMGVVSSG AQLTYGSNPY QPNQMTGAPG SVVTSVGNMQ  60
SEIEKVTDFK NHSLPLARIK KIMKADEDVR MISAEAPVIF ARACEMFILE LTLRSWNHTE  120
ENKRRTLQKN DIAAAITRTD IFDFLVDIVP REDLKDEVLA SIPRGTMPVA GPADAMPYCY  180
MPPQHAPQVG PAGVIMGKPV MDPNINLIPT WLHKCGRSHQ TNDNHLRIIS CYIVIVTFKL  240
RL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_B7e-4157151197NF-YC
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1123129RRTLQKN
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150381e-158AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015968567.11e-133PREDICTED: nuclear transcription factor Y subunit C-9
RefseqXP_015968568.11e-133PREDICTED: nuclear transcription factor Y subunit C-9
RefseqXP_016205500.11e-133PREDICTED: nuclear transcription factor Y subunit C-9-like
SwissprotQ8L4B25e-80NFYC9_ARATH; Nuclear transcription factor Y subunit C-9
TrEMBLI1NC071e-125I1NC07_SOYBN; Uncharacterized protein
STRINGGLYMA19G42460.11e-125(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF125734108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08970.43e-81nuclear factor Y, subunit C9