PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.G39ZQ
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family HB-other
Protein Properties Length: 1034aa    MW: 114825 Da    PI: 8.9837
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.G39ZQgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox16.71.3e-0569125157
                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
     Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                  +r+R  ++++ ++ ++++F  +  +s++e +e+++  g+t +qV+ +F  +R + ++
  Araip.G39ZQ  69 KRPRDLLNPKAVNYMQSVFSIKDAISKKESREISALFGVTVTQVRDFFNGQRSRVRR 125
                  799**************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.58866126IPR001356Homeobox domain
SuperFamilySSF466894.28E-668132IPR009057Homeodomain-like
SMARTSM003890.003368130IPR001356Homeobox domain
CDDcd000864.28E-469125No hitNo description
Gene3DG3DSA:1.10.10.602.2E-569138IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1034 aa     Download sequence    Send to blast
MDFPNDDFLE LPIGNSAESL QRFLASQRDL FHSQIDQFQE IVVTQCKLTG VNPLSQEMAA  60
GALSIKIGKR PRDLLNPKAV NYMQSVFSIK DAISKKESRE ISALFGVTVT QVRDFFNGQR  120
SRVRRFVLSS REKALKSNSC EEPHDELINS DPMRPINPAP LNSIMPSNAE GASCSTQDAA  180
LSDLDDLDKK FVDNIFSLME KEESFSGQEK LMEWILTIQN FSVLLWFLTR GGVMILATWL  240
SVAAVEEQTS VLLLILKVLC HLPLHKALPT HISAILPCVN RLRFYRTSDI SNRARVLLSK  300
WSKLLARDQA MKKPNGFKLS NDGQKDKIIG QIMGSESWDS NMNVHEDILA LSNDHSDNFR  360
KLESSQAVKL LPSSSDDSNK KLALGVSSSQ SNGPRERRKV QLVEQPGQKS VTRSPQATRV  420
APINQGRPMS ADDIQKAKMR ALFMQSKYAK NGSSKENKNV KIDGLHKHQT NQASIAACSA  480
KVPVPPRIED DKRTSLLPSS KATNRLETSY SKPRMDANEP VWEKCKRVQI PWKTPAEVKL  540
RDTWSVGAGE NSKEVDVQKN RNRREKETIY QTVQEIPSNP KEPWDLEMDY DDTLTLEIPI  600
EQLPDVDGAE LAFAPDEVAT HAVQGVATPS STSNVADTAQ PDLELLAVLL KNPDLVFALT  660
SGQGGSIPSE ETVKVLDMIK RGDMNLGTHD TNNGNGISAK PTEMVEVSLP SPTPSSDPRT  720
SGWSTMPPKN PFSRQSLAPA RSYPAVATTN LISQVPAIGT TVIRQQPTMA LPSSNPFTST  780
VVSSYSLPQA TIVPETEMQP PLSLSSLHVQ QTPLSDIGLT MKNKTSTNPS SVNLPGAHSP  840
LAMRVNGTSN VKPVPNMSVE DGLSNSFPQS FRLASTTPSL SATQQQQRHA HLASQQAHFP  900
EPSYRNSVHS YPPPQIEKPG QVSDSWRVRQ DVPSSSYHSN RNQNYYDNAY VGGSMQAGPS  960
WDRNNHATRE QYETWSPDNS PTRNPRYVPG RSYPESRVNQ HGRNHRPDWS RQRGSSGHWD  1020
PARQGNRKWH DERR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016205166.10.0PREDICTED: homeobox protein LUMINIDEPENDENS
SwissprotQ387961e-166LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLK7KG970.0K7KG97_SOYBN; Uncharacterized protein
STRINGGLYMA03G36970.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98092934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-144HB-other family protein