PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.FRS32
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 259aa    MW: 29944.5 Da    PI: 7.2305
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.FRS32genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.92.3e-50101381129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  lppGfrF P+deelv++yL kk+++++l    ++ e+d++ +ePw+Lp+ +k + +ewyfFs rd+kyatg r+nrat+sgyWkatgkd++v +  ++
  Araip.FRS32  10 LPPGFRFYPSDEELVCHYLYKKITNEQLLK-GTLVEIDLHICEPWQLPEVAKLNANEWYFFSFRDRKYATGFRTNRATTSGYWKATGKDRTVQDPlTQ 106
                  79*************************766.78***************88888999*************************************99999 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrle 129
                  e+vg++ktLvfy++rap+g kt W+mhe+rle
  Araip.FRS32 107 EVVGMRKTLVFYRNRAPNGIKTGWIMHEFRLE 138
                  99***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.23E-618156IPR003441NAC domain
PROSITE profilePS5100557.29810156IPR003441NAC domain
PfamPF023657.4E-2811137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MGLRDIGASL PPGFRFYPSD EELVCHYLYK KITNEQLLKG TLVEIDLHIC EPWQLPEVAK  60
LNANEWYFFS FRDRKYATGF RTNRATTSGY WKATGKDRTV QDPLTQEVVG MRKTLVFYRN  120
RAPNGIKTGW IMHEFRLETP HMPPKEDWVL CRVFHKSKEE NSAKLIMYDS ISTHHQSSNP  180
MALVSTHHLN PINNHNNTYH AMNNFLHHFS SSRDDSQTNN ANNNNSSVTQ ISPKGYDGYG  240
FIWDHMDLED GGVPSSDFQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-4711591171Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for axillary meristem initiation and separation of the meristem from the main stem. May act as an inhibitor of cell division. {ECO:0000269|PubMed:12837947, ECO:0000269|PubMed:17122068}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.FRS32
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. {ECO:0000269|PubMed:16854978}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020959922.10.0protein CUP-SHAPED COTYLEDON 3
SwissprotQ9S8519e-63NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBLA0A444YLY00.0A0A444YLY0_ARAHY; Uncharacterized protein
STRINGXP_004493788.11e-130(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43813359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.12e-93NAC domain containing protein 74
Publications ? help Back to Top
  1. Chen C, et al.
    Transcriptome profiling reveals roles of meristem regulators and polarity genes during fruit trichome development in cucumber (Cucumis sativus L.).
    J. Exp. Bot., 2014. 65(17): p. 4943-58
    [PMID:24962999]
  2. Gonçalves B, et al.
    A conserved role for CUP-SHAPED COTYLEDON genes during ovule development.
    Plant J., 2015. 83(4): p. 732-42
    [PMID:26119568]
  3. Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D
    SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis.
    Plant J., 2017. 90(3): p. 435-446
    [PMID:28161901]
  4. Espinosa-Ruiz A, et al.
    TOPLESS mediates brassinosteroid control of shoot boundaries and root meristem development in Arabidopsis thaliana.
    Development, 2017. 144(9): p. 1619-1628
    [PMID:28320734]
  5. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]