PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.F8I62
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 425aa    MW: 47885 Da    PI: 8.6637
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.F8I62genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM107.12.2e-332911640128
          NAM  40 ykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                  + ++P +L++++k++++ewyfFs  dkky +g r nrat++gyWkatg+d++v++ ++++vglkktLvf++grap+g++t+Wvmheyrl
  Araip.F8I62  29 TGANPGTLQSRLKTRDQEWYFFSALDKKYGNGGRMNRATSKGYWKATGNDRPVKH-EQRTVGLKKTLVFHSGRAPDGKRTNWVMHEYRL 116
                  4569****99999******************************************.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100537.5651144IPR003441NAC domain
PfamPF023652.7E-1612116IPR003441NAC domain
SuperFamilySSF1019418.89E-3929145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MRSLLSITSS ARFVAKASDL MQFLRLTSTG ANPGTLQSRL KTRDQEWYFF SALDKKYGNG  60
GRMNRATSKG YWKATGNDRP VKHEQRTVGL KKTLVFHSGR APDGKRTNWV MHEYRLVDEE  120
LERARSGSSQ PQKDAYVLCR VFHKNNIGPP NGQRYAPFVE EEWDDASALV PGAEPVEDVT  180
VTVAHPLRIE SNGRTLCSDR RNNVAQDTQS NNKVPFDVNK LPIETQSLLA VCKRESMAEF  240
PSPEKEDNSK RQIDEYPLPQ TENTKPISQI YKRRRHYLNV NHSNVNGDSV RTIQEPPCSS  300
TITTAATTLP TATTTASTAI TNVAPKKHFL SALVEFSLME SLESKGNPSV QPPEFDDASL  360
EASVPPNCVK LIKRMQGEIY KLSEERETMR FEMMSAQAMI NMLESRIEIL SKENEELKSM  420
INNNP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-303214656170Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00612ChIP-seqTransfer from AT3G10490Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.F8I62
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0105233e-31AP010523.1 Lotus japonicus genomic DNA, chromosome 5, clone: LjT23O16, TM1810, complete sequence.
GenBankAP0105243e-31AP010524.1 Lotus japonicus genomic DNA, chromosome 5, clone: LjT34P16, TM1824, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015941129.10.0uncharacterized protein LOC107466647
RefseqXP_025619941.10.0NAC domain containing protein 50 isoform X1
TrEMBLA0A444XRL20.0A0A444XRL2_ARAHY; Uncharacterized protein
STRINGGLYMA20G33430.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF81893241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10480.12e-83NAC domain containing protein 50