PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.F5AGL
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 330aa    MW: 37207.1 Da    PI: 8.2025
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.F5AGLgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM181.91.6e-56171431129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhPtdeel+++yL kkv ++++ + ++i evd++++ePwdLp k+k +ekewyfF+ rd+ky+tg r+nrat+sgyWkatgkdke+++ +++
  Araip.F5AGL  17 LPPGFRFHPTDEELITHYLYKKVIDTNFAA-RAIGEVDLNRCEPWDLPWKAKMGEKEWYFFCVRDRKYPTGLRTNRATESGYWKATGKDKEIFR-GKS 112
                  79*************************999.89***************888999****************************************.999 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrle 129
                  lvg+kktLvfykgrapkgekt+Wvmhe+rle
  Araip.F5AGL 113 LVGMKKTLVFYKGRAPKGEKTNWVMHEFRLE 143
                  ****************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-6513167IPR003441NAC domain
PROSITE profilePS5100559.67517167IPR003441NAC domain
PfamPF023652.9E-2918142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MEKVASLVLK EEEQMDLPPG FRFHPTDEEL ITHYLYKKVI DTNFAARAIG EVDLNRCEPW  60
DLPWKAKMGE KEWYFFCVRD RKYPTGLRTN RATESGYWKA TGKDKEIFRG KSLVGMKKTL  120
VFYKGRAPKG EKTNWVMHEF RLEGKFSIHN LPKTAKNEWV ICRVFRKSSA GKKVHISGIM  180
RLDTFRTELD SSGLPPLTET SPSFDTIHDE SPYVPCFSNP IDVPRNQAAG GSGGGGGVFG  240
GSFPNNSSSS VSAYAVSSNI LPRMPICGGS LYSTQHQDQS ILRALYESNE REMISVSQET  300
GLTTEMNVET NSVVSNFDIG RAHFESLWNY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-561417314171NO APICAL MERISTEM PROTEIN
1ut4_B6e-561417314171NO APICAL MERISTEM PROTEIN
1ut7_A6e-561417314171NO APICAL MERISTEM PROTEIN
1ut7_B6e-561417314171NO APICAL MERISTEM PROTEIN
4dul_A6e-561417314171NAC domain-containing protein 19
4dul_B6e-561417314171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.F5AGL
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016192125.10.0NAC domain-containing protein 100
SwissprotQ9FLJ21e-138NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A445G4X01e-164A0A445G4X0_GLYSO; NAC domain-containing protein 100
TrEMBLV7CEG81e-164V7CEG8_PHAVU; Uncharacterized protein
STRINGXP_007155297.11e-165(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-137NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]