PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.EDF1T
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family SBP
Protein Properties Length: 498aa    MW: 54691.1 Da    PI: 7.3483
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.EDF1TgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP135.81.3e-42126201277
                  -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
          SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                  Cqv gC++dls+ k+yh+rhkvCevhsk++vv+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q
  Araip.EDF1T 126 CQVYGCNKDLSSSKDYHKRHKVCEVHSKTAVVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPQ 201
                  **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.0E-34120187IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.547123200IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.96E-39124203IPR004333Transcription factor, SBP-box
PfamPF031102.5E-32126199IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 498 aa     Download sequence    Send to blast
MESSWDYVTE EEKGYVSNDA LSAAPPPPPS TLLRSKSSFL GWELKTPCSS FDNQCFEELG  60
FPELLGKPFS GRDSLIDLKL GRFADHADVN VASFSKGAPV LCSSVSSTAP KRPRGSLGLH  120
SQTAYCQVYG CNKDLSSSKD YHKRHKVCEV HSKTAVVIVN GIEQRFCQQC SRFHLLAEFD  180
DGKRSCRKRL AGHNERRRKP QAGIHSGKAA RLPHPCGSVL VVLVDSRFQG TMLSSASFIS  240
SDSDKYGMSS FWKPGKAEHG SDFWHPQSRS LFPSYNGKQF PFLHESGATP TTTESILYEN  300
NNQYKHVIAA QHPGSRPLFQ NSSLGSDDFN LFDTSSTVQG LSGISDSCCA LSLLSSQSQN  360
SSSQSSGIPF VPPMVSPSSH SHPCSISQVS EKIGMSSQTS SCRVYDRFPS TLNPASGSQL  420
SPILISDNNN IVNLEMADRI FQGSDFVNAR DRLSCEDVAT IDLLQLSSQL QRVEHQRQSL  480
QEFNSTDTFA VNLILIWC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-29115199484squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.EDF1T
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016193761.10.0squamosa promoter-binding-like protein 6 isoform X1
TrEMBLA0A445AZ730.0A0A445AZ73_ARAHY; Uncharacterized protein
STRINGGLYMA0005S50.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.15e-47SBP family protein