PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.E6J0R
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 225aa    MW: 25562.1 Da    PI: 8.3405
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.E6J0RgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.91.7e-4361051100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +Ca+Ck+lrr+C+k+C++apyfp+++p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA ar+rdPvyG+vg i+ lq+q+ ql+ +la+++
  Araip.E6J0R   6 PCASCKLLRRRCTKECIFAPYFPSDDPRKFAIVHKVFGASNVSKMLQELPIDQRGDAVSSLVYEATARVRDPVYGCVGAISYLQNQVTQLQMQLAVAQ 103
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  Araip.E6J0R 104 AE 105
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.5685106IPR004883Lateral organ boundaries, LOB
PfamPF031954.8E-436103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MGGSSPCASC KLLRRRCTKE CIFAPYFPSD DPRKFAIVHK VFGASNVSKM LQELPIDQRG  60
DAVSSLVYEA TARVRDPVYG CVGAISYLQN QVTQLQMQLA VAQAEILSIH QMQQDPSNNN  120
TTLLPSQLLD QDYSEKFLLL SSAENNNNYD FLPQYLSFAS SSSSSSNVFQ DSEPLKRDNC  180
MLVYVYHVRE TRIGRWGPKR KTKEKIFNKG EILVYIYHNF GLYNF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150383e-48AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016203847.11e-137PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW32e-69LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A151QRV11e-88A0A151QRV1_CAJCA; LOB domain-containing protein 12
STRINGGLYMA11G29450.14e-85(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.13e-70LBD family protein