PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.DR280
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 304aa    MW: 34738.8 Da    PI: 7.1958
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.DR280genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM57.16.3e-18247349
          NAM  3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49
                 pGfrFhPtdee+v +yLk+k+++k+l++ e ik+vdiyk+ePwdLp+
  Araip.DR280  2 PGFRFHPTDEEIVGFYLKRKIQQKSLPI-ELIKQVDIYKYEPWDLPN 47
                 9***************************.89**************93 PP

2NAM65.61.4e-205110773128
          NAM  73 rknratksgyWkatgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                   +nr+t+ g+Wkatg+d++++s+  ++ +glkk+Lvfy+gra kg ktdW+mhe+rl
  Araip.DR280  51 WPNRVTRCGFWKATGTDRPIYSSeAQSIIGLKKSLVFYRGRAAKGFKTDWMMHEFRL 107
                  689*******************8556679**************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100535.7831137IPR003441NAC domain
SuperFamilySSF1019418.24E-432137IPR003441NAC domain
PfamPF023652.2E-212107IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MPGFRFHPTD EEIVGFYLKR KIQQKSLPIE LIKQVDIYKY EPWDLPNEKI WPNRVTRCGF  60
WKATGTDRPI YSSEAQSIIG LKKSLVFYRG RAAKGFKTDW MMHEFRLPSL SSDSAKKCSD  120
KTTPASDSWA ICRIFKKTNT MSMAQKASLS HHPYNWNHHN QLFDDILTHQ QHQHPIIPNS  180
NNNFIFYNSN STLEPTKEID ATTTSSSIVI SSNIGLHEDP NHHHYNNNSS GFSSSSIMMM  240
QPNIMATSDD DDSGVITTIA GFPFNLPPND DDAAWNNNIK PNTTLPWDYL SDMSTTYSTN  300
KSYT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-36214619171NO APICAL MERISTEM PROTEIN
1ut4_B3e-36214619171NO APICAL MERISTEM PROTEIN
1ut7_A3e-36214619171NO APICAL MERISTEM PROTEIN
1ut7_B3e-36214619171NO APICAL MERISTEM PROTEIN
4dul_A3e-36214619171NAC domain-containing protein 19
4dul_B3e-36214619171NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.DR280
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020970347.10.0protein FEZ-like
TrEMBLA0A445B3911e-171A0A445B391_ARAHY; Uncharacterized protein
STRINGGLYMA19G02580.16e-85(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20133490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39820.14e-66NAC domain containing protein 94