PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.DL86S
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 349aa    MW: 39144.9 Da    PI: 8.2834
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.DL86SgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.42.3e-52141391128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrF Ptdeel+v+yL++kv+g++++l e+i e+d+yk++Pw Lp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk++++ +g+
  Araip.DL86S  14 LPPGFRFYPTDEELLVQYLCRKVAGHHFSL-EIIGEIDLYKFDPWVLPSKAIFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKTITT-EGR 109
                  79***************************9.99***************7777799***************************************.999 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  +vg+kk Lvfy g+apkg+kt+W+mheyrl
  Araip.DL86S 110 KVGIKKALVFYIGKAPKGTKTNWIMHEYRL 139
                  ****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-6610162IPR003441NAC domain
PROSITE profilePS5100560.34114162IPR003441NAC domain
PfamPF023652.7E-2615139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MGIQEKDPLS QLSLPPGFRF YPTDEELLVQ YLCRKVAGHH FSLEIIGEID LYKFDPWVLP  60
SKAIFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKTITTEGRK VGIKKALVFY  120
IGKAPKGTKT NWIMHEYRLL DSTRKNGSTK LDDWVLCRIY KKNSSAQQKV PNGVVSSSEQ  180
YATQYSNGSS SNSSSSHLDE VLESLPEIDD RCFALPRVNS LRALQQQRHH QEDTKVGLLQ  240
QQQQQGLVAG TGSFLDWASG PGILNDLGQA QQGIVNYGND LFVPSVCHVD SNLVPAKIEE  300
EVQSGVKTQS AFFQQGPNPN DFTQAFSNQL DPYGFSRYSV QPVGFGFRQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-11011684171NO APICAL MERISTEM PROTEIN
1ut4_B1e-11011684171NO APICAL MERISTEM PROTEIN
1ut7_A1e-11011684171NO APICAL MERISTEM PROTEIN
1ut7_B1e-11011684171NO APICAL MERISTEM PROTEIN
3swm_A1e-11011687174NAC domain-containing protein 19
3swm_B1e-11011687174NAC domain-containing protein 19
3swm_C1e-11011687174NAC domain-containing protein 19
3swm_D1e-11011687174NAC domain-containing protein 19
3swp_A1e-11011687174NAC domain-containing protein 19
3swp_B1e-11011687174NAC domain-containing protein 19
3swp_C1e-11011687174NAC domain-containing protein 19
3swp_D1e-11011687174NAC domain-containing protein 19
4dul_A1e-11011684171NAC domain-containing protein 19
4dul_B1e-11011684171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in abscisic acid-mediated stomatal closure (PubMed:25005917). Regulates the expression of NCED1, a gene involved in the biosynthesis of abscisic acid (ABA) (PubMed:25005917). Required for the stomatal closure induced by the bacterial pathogen Pseudomonas syringae pv tomato DC3000, but not for stomatal reopening (PubMed:25005917). {ECO:0000269|PubMed:25005917}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00012PBMTransfer from AT1G52890Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraip.DL86S
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA), dehydration and wounding. {ECO:0000269|PubMed:25005917}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF5463580.0HF546358.1 Arachis hypogaea mRNA for NAC2 transcription factor (NAC2 gene), cultivar L12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016170502.10.0NAC domain-containing protein 72
RefseqXP_025670804.10.0NAC domain-containing protein 72
SwissprotQ9SQL01e-127JA2_SOLLC; NAC domain-containing protein JA2
TrEMBLA0A444Y4K20.0A0A444Y4K2_ARAHY; Uncharacterized protein
STRINGGLYMA13G35550.11e-170(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44293360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-122NAC family protein
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]